SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0173432 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173432
Domain Number 1 Region: 101-205
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000592
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173432   Gene: FBgn0146938   Transcript: FBtr0174940
Sequence length 209
Comment type=protein; loc=scaffold_6540:join(7911260..7911512,7912071..7912447); ID=FBpp0173432; name=DmojGI24215-PA; parent=FBgn0146938,FBtr0174940; dbxref=FlyBase:FBpp0173432,FlyBase_Annotation_IDs:GI24215-PA,GB_protein:EDW14351,REFSEQ:XP_001998890,FlyMine:FBpp0173432; MD5=dc44513db5cd8c87587301bf4fcd7b4d; length=209; release=r1.3; species=Dmoj;
Sequence
MCWCARVYWTVLQNLFARLFNSLTDRNCASGYRRSCCVCCGSYRRQPGDSDSDADAESDA
AKQVSESIVDDDLRRAAPHDYVIVDEADANYVEIEQRQIETEQYYFTVDRSMAERMLYQR
EDGACLVRPFKATDVCIKYIVSIWAGGNYYHLFVRQIDMRQRFAIGQWKPHERHFSSPCE
IIEFYAEHPLLCTNKERSQSVRLKPISYA
Download sequence
Identical sequences B4K817
FBpp0173432 XP_001998890.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]