SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384433847|ref|YP_005643205.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384433847|ref|YP_005643205.1|
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.17e-19
Family Pseudouridine synthase II TruB 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384433847|ref|YP_005643205.1|
Sequence length 89
Comment hypothetical protein [Sulfolobus solfataricus 98/2]
Sequence
MILNDFIYKIDNFCGYKNEWKIRKDSETSDKYGYYPEKRPIEIHIKNSIINLDKPPGPTS
HEVAYWVKKMLNVTKAGHGGTLEPIHWAG
Download sequence
Identical sequences A0A0E3JTW6 D0KS85 Q980C2
gi|15897326|ref|NP_341931.1| 273057.SSO5761 gi|384433847|ref|YP_005643205.1| WP_009988802.1.14611 WP_009988802.1.22626 WP_009988802.1.43719 WP_009988802.1.57434 WP_009988802.1.66040 WP_009988802.1.8449 WP_009988802.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]