SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384433937|ref|YP_005643295.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384433937|ref|YP_005643295.1|
Domain Number 1 Region: 59-108
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0000902
Family PspA lactotransferrin-binding region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384433937|ref|YP_005643295.1|
Sequence length 112
Comment twin-arginine translocation protein, TatA/E family subunit [Sulfolobus solfataricus 98/2]
Sequence
MKAKFLISRRDITYKDGSMFNNPYDWVILLVVVAVLFFGASKIPELFRSMGRAVGEFKKG
RVEAEMELQQMQAQNLQQPSVQQQQPNVQDLEKQIAELQKQLEELKKSKQNQ
Download sequence
Identical sequences D0KSH5
WP_009989546.1.14611 WP_009989546.1.22626 WP_009989546.1.57434 WP_009989546.1.66040 gi|384433937|ref|YP_005643295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]