SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0161135 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161135
Domain Number 1 Region: 265-562
Classification Level Classification E-value
Superfamily L domain-like 4.65e-38
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 762-913
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.72e-36
Family Toll/Interleukin receptor TIR domain 0.000034
Further Details:      
 
Weak hits

Sequence:  FBpp0161135
Domain Number - Region: 116-235
Classification Level Classification E-value
Superfamily L domain-like 0.00918
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161135   Gene: FBgn0134676   Transcript: FBtr0162643
Sequence length 923
Comment type=protein; loc=scaffold_6680:complement(12227531..12227756,12227882..12228009,12228072..12229690,12229787..12230020,12230111..12230341,12233165..12233498); ID=FBpp0161135; name=DmojGI11918-PA; parent=FBgn0134676,FBtr0162643; dbxref=FlyBase:FBpp0161135,FlyBase_Annotation_IDs:GI11918-PA,GB_protein:EDW18728,REFSEQ:XP_002008252,FlyMine:FBpp0161135; MD5=15f62f815c8b24cb6044f6c1ebb6f688; length=923; release=r1.3; species=Dmoj;
Sequence
MTIVLRACLIVFLLHWNINESSFQDADLVPEIPLQSSLHLSENLNNAFENDNQNTEGPET
NTDSTEDTDMNSAFVKYSTDDGNTCLLDNIKQDILWWAFPNGTLKTTSAKYATNMHLDLS
YGNISDDEELLNKTRFAHRYRLQKVEVFSAAYNSLNAVPFQTLNTMSKSLKYLSLQGNQF
AALNHDVEAIEQFLHETLNTNPDNGTQINCEVLADNNNNNYDLYDRECSSYHQSNKKIDS
QINTQDIIYEEYIRKIKIKHKRFGKSMQSIAWATFPSLPNLLELEISNCSIEYVSRKAFK
NVTNLRKLFISNNKIMTIDIDTFYYIPKLQYLDLSFTNVLNYNYLFSMPTLEMIFNLVYG
LKIHQAAFKYLPDLIYLDLSHSKITKNSAVAFTYLGDKLKYLSLCYTSFPMMSNGLFKNT
ILEGLDLSGNPFVSYNILDDAFDSTSETLKFLFFEHSNLKDLDWLKPLNKLQLLSLAGNN
INALDVDIFKSLVSLKQLDLSYNHIGNWYKSVFSHNKQLRVLNLRSNNVNMLTTEMLKDF
ELLEYLSLGSNNFLCNCNLREIVEVAANNNKEASCSIDYLQTAADELIYQLNDSNMSRLS
NVLNNHIEWELWNRKYIPLLNDSYKNIKDFKRLKNIVKLHFVSNNISSSQCPVSRPTTVN
DTKLKFQLLDYDAKNYWCFNETEKLQVDELVCQSRNLIVLERELHNAMKIITATVGSLLF
MFILGFVIYLKRWHIHYYYASLKSAALLSTAAKDRIRHLAESDPSVIYDIFISYCQNDRQ
WLLDELLPNVEKSGDISICLHERDFQIGVTILDNIISSMDRSRSLMLLISSKFLLSHWCQ
FEMYLAQHRIFEMSKEHLILVFLEDIPRSKRPKTLQYLMDIKTYIKWPSKGNKQPSLEER
KLFWKRLRKSLESIGIGTKDSRV
Download sequence
Identical sequences FBpp0161135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]