SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0161292 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161292
Domain Number 1 Region: 13-185
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-41
Family Phosphotyrosine-binding domain (PTB) 0.0000232
Further Details:      
 
Domain Number 2 Region: 311-409
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-25
Family SH2 domain 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161292   Gene: FBgn0134832   Transcript: FBtr0162800
Sequence length 422
Comment type=protein; loc=scaffold_6680:complement(10518899..10519590,10519621..10520009,10520101..10520288); ID=FBpp0161292; name=DmojGI12075-PA; parent=FBgn0134832,FBtr0162800; dbxref=FlyBase:FBpp0161292,FlyBase_Annotation_IDs:GI12075-PA,GB_protein:EDW18477,REFSEQ:XP_002008001,FlyMine:FBpp0161292; MD5=bbfbf1907e64f1d654e6d5e39022b27b; length=422; release=r1.3; species=Dmoj;
Sequence
MPRNGGDAGNGGTGSNATSDGCIYPDDVILEKGVTFNVRYTGCVEVKTSMKSLDFETRTL
LARECINRVCEAAGLKSVSKRRLDKRLHNFISDRPSMEHAGTNIIINVSSRALTLSNVET
GEVIASHNMPRISFASGGDNDTLDFLAYIAKREGDEWRACYVLECAGGQSEDLIVTIGKA
FVLRFNALSRQNSAATTDNINLSCKENVKEYYNDLPNKLPPDLPCDEPQLQAQQPLAQAQ
IPLHPHAPRVAQLNLKKPRDRLSSNLIDLNSPPPDQTTNKHSLGHFDPLQAGSVAAGVAT
NSIRDVFDGPQCPLTAEIWFHAAISRPIAERLLQQDGDFLVRESQGKRGQYVLTGLEGKT
PKHLLLIDPEGVVRTKDRIFDSISHLINYHWVHALPIISEDSELVLRNPVRRPNLEQSTD
NA
Download sequence
Identical sequences FBpp0161292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]