SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162319 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162319
Domain Number 1 Region: 86-463
Classification Level Classification E-value
Superfamily L domain-like 3.4e-56
Family Ngr ectodomain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 375-700
Classification Level Classification E-value
Superfamily L domain-like 5.1e-51
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 3 Region: 1075-1218
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-42
Family Toll/Interleukin receptor TIR domain 0.0000738
Further Details:      
 
Domain Number 4 Region: 809-950
Classification Level Classification E-value
Superfamily L domain-like 3.85e-31
Family Ngr ectodomain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162319   Gene: FBgn0135859   Transcript: FBtr0163827
Sequence length 1374
Comment type=protein; loc=scaffold_6680:7721530..7725654; ID=FBpp0162319; name=DmojGI13102-PA; parent=FBgn0135859,FBtr0163827; dbxref=FlyBase:FBpp0162319,FlyBase_Annotation_IDs:GI13102-PA,GB_protein:EDW18192,REFSEQ:XP_002007716,FlyMine:FBpp0162319; MD5=810ff2324a5c8c7704fe540b0a332064; length=1374; release=r1.3; species=Dmoj;
Sequence
MLASHMLYVLIASCVMPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELEN
TNFSVIQPHNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTEGSFRGL
QELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHL
NASYNKIQDISNFYFSASLSSRKSRVCGSTLQSLDLSANKMVSLPSAMLSALVRLTHLNM
ARNSMSFLADRAFEGLISLRVVDLSANRLTSLPPELFAETKQLQEIYLKNNSINVLAPGI
FGELAELLVLDLANNELNSQWINAATFVGLKQLVLLDLSANKISRLEAHIFRPLASLQVL
KLEGNYIDQLPAGIFADLGNLHTLILSNNRISVIEQRTLQGLNNLQVLSLDYNRLTRLDA
RALINCSQLQDLHLNDNKLQTVPEALVHVPLLKTLDVGENMITQIENTSITQLENLYGLR
MTENSLTHIRRGVFERMSSLQILNLSGNKLKSIEAGALQRNTQLQAIRLDGNQLKSIAGL
FTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIENELSLSTFDAS
YNLLSEITASSIPNSVEVLYLNDNLISKIQPYTFFKKPNLTRVDLVRNKLTTLEPNALRL
SPIAEDREIPEFYIGHNAYQCDCNLDWLQKINRESRTQPQLMDLDQIYCKLSYARGATHL
SLIEAKSNDFLCKYESHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRASY
DRSLPSHIPMDATQLYLDGNHFAELQSHAFIGRKRLKVLHLNHSRIETLHNRTFYGLLEL
EVLQLQNNQLSALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIGT
FAVWNFLPSYLNELRLSGNPWSCQCEFIDKLRDYTNRHEYVLDRQQLRCEMPGNSTQQQA
VQMAIFAAAGETLPVVQCSQTLQLGLDNSFNAAERAGAGAGEAAGGNMTSTKMILTQPPK
QDYIPILVAILTAFIFIMICTLLVFIFRQEMRVWCHSRFGVRLFYNGQKDVDKNEREKLF
DAFISYSSKDELFVNEELAPMLELGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIM
VVSENFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQW
GDKLFWQKLRFALPDVSSSHHAQRSGQPCHAPINHPAYHHHHHLQQQQQQHLQQQQQQLP
LHAAHSVPHPHHHQQQFMLPPPPLPLQPGSFRRQPSTQQQHRSNANINNNNQQQQQQAAL
LMGGGGGGGGGGGGVVPGAQPQMIPLAGGIQQQSLPLPPQGTSQPTPASRNLHM
Download sequence
Identical sequences B4L135
FBpp0162319 XP_002007716.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]