SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162718 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162718
Domain Number 1 Region: 165-472
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.9e-40
Family NodB-like polysaccharide deacetylase 0.011
Further Details:      
 
Domain Number 2 Region: 62-104
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 119-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162718   Gene: FBgn0136256   Transcript: FBtr0164226
Sequence length 538
Comment type=protein; loc=scaffold_6680:join(14065197..14065251,14066735..14066898,14067012..14067261,14077834..14078981); ID=FBpp0162718; name=DmojGI13501-PA; parent=FBgn0136256,FBtr0164226; dbxref=FlyBase:FBpp0162718,FlyBase_Annotation_IDs:GI13501-PA,GB_protein:EDW18929,REFSEQ:XP_002008453,FlyMine:FBpp0162718; MD5=86f7ef25b70421f0b05881305e508163; length=538; release=r1.3; species=Dmoj;
Sequence
MAKLFVVFAVLALAAIGSASAQVRVKRQSSTEEPKKEESFEKELCKDKDAGEWFRLVAGE
GDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLLHTDEP
LCQDGFLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCFC
SEDGTSIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKGRKNPNGCDIKATYFVSHK
YTNYSAVQETSRKGHEIAVHSITHNDEERFWSNATVDDWAKEMAGMRIIIEKYANITDNS
VVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQSC
PTRSHAVWEMVMNELDRREDPANDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQN
RAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTVSEVKN
FEPWREKCVVDGKPACWVPNSCKLSSKEVPGETINLQTCVRCPNNYPWLNDPTGDGFF
Download sequence
Identical sequences B4KZA3
FBpp0162718 XP_002008453.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]