SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0164187 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164187
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.5e-31
Family NodB-like polysaccharide deacetylase 0.024
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000115
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164187   Gene: FBgn0137721   Transcript: FBtr0165695
Sequence length 490
Comment type=protein; loc=scaffold_6473:complement(7230934..7231273,7236099..7236484,7237914..7238133,7255447..7255589,7264735..7264862,7273218..7273329,7273404..7273495,7284214..7284265); ID=FBpp0164187; name=DmojGI14970-PA; parent=FBgn0137721,FBtr0165695; dbxref=FlyBase:FBpp0164187,FlyBase_Annotation_IDs:GI14970-PA,GB_protein:EDW07253,REFSEQ:XP_002009936,FlyMine:FBpp0164187; MD5=1307a1215b943e096eea981fa42278ec; length=490; release=r1.3; species=Dmoj;
Sequence
MLQHCLIAALLIAVGVHAQNKDKEEFQCPSHIANGNYADPVTCRRFYQCVDGFPYLNRCP
SGLYFDDLQKFCTFKDEAKCGPLPTTPAPATDAPADTAQRCDTEACQLPYCFCSKDGTQI
PGNLEAEKIPQIIMLTFDGAVNLNNYDHYQKIFNGKRKNPNGCNIRGTFFLSHEYSNYQQ
IQHLGFAGHEIATESVSQQLGLQDKGYEEWVGEMIGMREILRHFANVSVDDVVGMRAPFL
KPGRNTQYKVLEDFGYVYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGFEGGHCPYMDQCVLHNLDENEVFEWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTITQMLQYMTDPKELRDVNQIEAWKCDKSVAVAPKP
CNIWNTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGISGRDNYNYSVNKNEP
EEEDDAEQRK
Download sequence
Identical sequences FBpp0164187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]