SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0164391 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164391
Domain Number 1 Region: 513-873
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.83e-112
Family Histone deacetylase, HDAC 0.00000115
Further Details:      
 
Domain Number 2 Region: 83-439
Classification Level Classification E-value
Superfamily Arginase/deacetylase 3.07e-104
Family Histone deacetylase, HDAC 0.00000175
Further Details:      
 
Domain Number 3 Region: 961-1057
Classification Level Classification E-value
Superfamily RING/U-box 6.47e-25
Family Zf-UBP 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164391   Gene: FBgn0137924   Transcript: FBtr0165899
Sequence length 1137
Comment type=protein; loc=scaffold_6473:complement(2820590..2821071,2821833..2821920,2822063..2822686,2822754..2824170,2824240..2824511,2825045..2825228,2825323..2825453,2826258..2826473); ID=FBpp0164391; name=DmojGI15174-PA; parent=FBgn0137924,FBtr0165899; dbxref=FlyBase:FBpp0164391,FlyBase_Annotation_IDs:GI15174-PA,GB_protein:EDW06869,REFSEQ:XP_002009552,FlyMine:FBpp0164391; MD5=824517e560be887c5cc2745c0b475639; length=1137; release=r1.3; species=Dmoj;
Sequence
MVKSKSASSSSSTATSLNAAAGPNANGSAGSCGPRKTSPALQEAKRRARNMLKSQSNGLG
SQLEPIIDIFQNAVNAKSMHRGATALIYDESMSEHCCLWDSTHQERPERFTRTMERCREL
NLVDRCLQLKSRLATKDEILKLHSIEHYERLEQTSGVRNEEAMEELSSHYDAIYIHPSTF
KLSLLASGSTIELIDQLLLGKAQNGMAIIRPPGHHAMKSEFNGYCYFNNVALAAQHALEA
HQLQRILIIDYDVHHGQGTQRFFYNDSRVLYFSIHRYEHGSFWPNLQESDYHAIGSGPGT
GYNFNVPLNTKGMGNGDYLAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMEVTPA
CYPHLLNPLLHLANCRVAVVLEGGYCVESLSEGAALTLRALLGDPCPPLVERLELPSMEL
RESVLNCIYVHRPYWRCLQLQQTYTPADLESESAATAQLHRVKRIWLGGPPPEPDQRYPT
RGTSAQLPEDVVARNAARLSVLRAETQLSVPAIRVCYAYDAQMLQHFNLHDATHPEQPMR
IRQIHQMHDDYQLLGRMHQLSARAATTDEVCLAHTRAHVNSVRRLLGRSVEELQQMGAGY
NSVYLHPRTFECATLASGSVLQAVDSVLRGQSRSGICNVRPPGHHAEPDQPHGFCIFNNI
AIAAQYAIREFGLERILIVDWDVHHGNGTQHIFESNPKVLYMSIHRYEHGAFFPKGPAGN
YDMVGKNAGRGFNVNIPWNKKGMGDLEYALAFQQLILPIAYEFNPQLVLVSAGFDAAIGD
PLGGCKVTPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQ
FIPAAQRSATVAFQSCVETLQLCVEQQHQYWKSLVFGCKLPQCVLGENNNEDFLAATMSQ
LSISNDNALGAVGGDASQQPDPGQDRPSGSKPKVKVKTLTEFMAEHKEALEQQEMFAIYP
LKSCPHLSQLRSEQAPKSINTSGACGDCGSMVENWMCLSCQSIGCGRYINEHMEQHCRRA
QHPLVLSFSDLSVWCYECNNYIDHPLLYVYQNLAHVDKFKEPMPWTHGCQQRTDGCYPIQ
LDAADSNKQNNNNNNNNNHGASGCSSNANTNNDDDNGSGSGSGSDGVSYYIQLERNN
Download sequence
Identical sequences FBpp0164391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]