SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0166255 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0166255
Domain Number 1 Region: 16-117
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-28
Family SH2 domain 0.0000538
Further Details:      
 
Domain Number 2 Region: 317-419
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-22
Family SH2 domain 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0166255   Gene: FBgn0139783   Transcript: FBtr0167763
Sequence length 504
Comment type=protein; loc=scaffold_6500:join(2544541..2544699,2544775..2545463,2550478..2551144); ID=FBpp0166255; name=DmojGI17038-PA; parent=FBgn0139783,FBtr0167763; dbxref=FlyBase:FBpp0166255,FlyBase_Annotation_IDs:GI17038-PA,GB_protein:EDW11237,REFSEQ:XP_002001795,FlyMine:FBpp0166255; MD5=66c49c209e9666a12006afd449d2e882; length=504; release=r1.3; species=Dmoj;
Sequence
MRPQAPASMARDSKKDELRSAPWYWGSISREQAKNKLFGQPDGSFLVRDAQAKKGEYTLT
LMKDGNEKLIKICQINDNYGFVEKFQFSSVVEMINHYMTNSLKMYNKTLDITLSNPIVCP
FYEDSQPQGDLRLLCDAFVRCSQLLLQQEQALDQKKKSFNAIREELAEKKLHQSVFGNAE
NMFRSQIASIESFMNKPPVNATGIGTGAGGAGGAQCSRQEVEQHMRENLLRMNTHLKVMH
AKMERLNQEIKMRKEEEQLLERQINASKPELQELQLCKDKHIERLKGFGLTDDDLNVILE
KGFDELQQNYEKASNQPHRNEALWLIKEAKRQDAEEMLSGAPTGTFLIRARDAGHYALSI
VCKSVIHHCIIYETESGLGFAAPYNIYPTLKKLVDHYATNSLEEHNDKLTTVLRIPVRYW
LQNKQQLMEQLQEELELEQEQERLAQEAALMPPPLPPQATASSAPIPTTRSREHRGHDSI
DAAFSIETETPPASISPSNFSTSQ
Download sequence
Identical sequences FBpp0166255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]