SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167752 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167752
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.4e-25
Family Insect pheromone/odorant-binding proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167752   Gene: FBgn0141274   Transcript: FBtr0169260
Sequence length 135
Comment type=protein; loc=scaffold_6496:complement(21052097..21052447,21052506..21052562); ID=FBpp0167752; name=DmojGI18535-PA; parent=FBgn0141274,FBtr0169260; dbxref=FlyBase:FBpp0167752,FlyBase_Annotation_IDs:GI18535-PA,GB_protein:EDW10439,REFSEQ:XP_002006504,FlyMine:FBpp0167752; MD5=1035035c49f7f659786cc0f164e7ce9b; length=135; release=r1.3; species=Dmoj;
Sequence
MKSRFACILLFSCLISYVMAQKPEMTQQVVSSCMTENGVTEQELNGLKSGEVKLEDVKDN
VKCASQCVMAKLGFMNSKGVLQDDKIMEFFKDGPMKGQAEKALEACGSTTGANPCDTAFQ
IMVCLEKHVNDLMKA
Download sequence
Identical sequences B4KRL3
FBpp0167752 XP_002006504.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]