SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169085 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169085
Domain Number 1 Region: 632-781
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-40
Family Toll/Interleukin receptor TIR domain 0.00016
Further Details:      
 
Domain Number 2 Region: 175-382,459-576
Classification Level Classification E-value
Superfamily L domain-like 1.15e-32
Family Ngr ectodomain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169085   Gene: FBgn0142605   Transcript: FBtr0170593
Sequence length 794
Comment type=protein; loc=scaffold_6500:complement(29069095..29070433,29071886..29072931); ID=FBpp0169085; name=DmojGI19868-PA; parent=FBgn0142605,FBtr0170593; dbxref=FlyBase:FBpp0169085,FlyBase_Annotation_IDs:GI19868-PA,GB_protein:EDW13456,REFSEQ:XP_002004014,FlyMine:FBpp0169085; MD5=40100b5434fdf44efbd8286a8058c372; length=794; release=r1.3; species=Dmoj;
Sequence
MLDSRYLIVVICAVACANAQIVPLSNYCRHVHTWCTCEPQANLVRIFCREEYAMILQFAD
TGYNIAMSYYASGDIHWLPRLNISQVAQFEFDAYNYWSDTFFGELLNTLGVEQVLSIQFR
DRSFQADVQLNPDEDVFALDMDSPDAGGQNASTWLFSDVPMLEYFKYESHQHVLSESIFH
AFHNLTTLELRLSVHHLPSRLFSSIAHSLHTLSISNPYRLLLQPGVLQELRQLRNLTLQL
ARSPDNRSKRRLSPLFISMPQLEELHLTRATSYVNSTMLRGSYSLRLIGINRNPELTELP
SELFHDQGNLTVLDLSRNCLAKLPIDLLNGLAKLKRLDLSNNRLANLSSELFTSLTSLST
LVLNQNPLTSLDPRTFGNVRSLNLVDMRGTQFYGIKLWMPFEALVCTNDDVCQYKSADWE
CDRRCICWVQRHTRQLYVDCRGAQLSELPVLPQTTLVQTTLKLRNNSISQLPDANATVGY
ANVTKLSLADNQLSSLNAVQQLPSNLSLLDVRFNQITVFDQDFINYMTNSTMDLALGGNP
LSCDCSALPLLGFVRAQPQRIHDMGDIYCSEWPDRPFLQLEVGELCPSYVLLVGCILGGL
VIVICLFSVVYLIYQQELKIWLYNHNLCLLFVSEEELDKDKTYDAFISYSHKDEQLIGEL
LPKLETGLHAYRVCLHGRDWLVGDCIPEQIVRTVNDSKRVIIVLSQHFINSVWARMEFRI
AYQATLQDKRKRIIIILYKELEHFEGIDSELRAYLKLNTYLKWGDPLFWSKLRYAMPHNR
RVLKGQKKHAGPLI
Download sequence
Identical sequences B4KIF9
XP_002004014.1.58863 FBpp0169085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]