SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170305 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170305
Domain Number 1 Region: 425-760
Classification Level Classification E-value
Superfamily L domain-like 4.76e-50
Family Internalin LRR domain 0.062
Further Details:      
 
Domain Number 2 Region: 93-446
Classification Level Classification E-value
Superfamily L domain-like 1.02e-45
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 3 Region: 843-1012
Classification Level Classification E-value
Superfamily L domain-like 4.86e-29
Family Ngr ectodomain-like 0.027
Further Details:      
 
Domain Number 4 Region: 1102-1242
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.02e-21
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170305   Gene: FBgn0143820   Transcript: FBtr0171813
Sequence length 1445
Comment type=protein; loc=scaffold_6496:21126999..21131336; ID=FBpp0170305; name=DmojGI21088-PA; parent=FBgn0143820,FBtr0171813; dbxref=FlyBase:FBpp0170305,FlyBase_Annotation_IDs:GI21088-PA,GB_protein:EDW10441,REFSEQ:XP_002006506,FlyMine:FBpp0170305; MD5=9462ee5a6c9ed76ace1b4d35f71518f8; length=1445; release=r1.3; species=Dmoj;
Sequence
MELRLLLLLSLLLLAGCAGCLGAVPPKPKDASDKNAASAMLGSSVSLSSDYSSLLAAAQP
MAASSPAPVHSGPNNQCTWTYNGTSSVHCSLRLIERQPCLDLQGADGSSQLTIKCSDLYL
FESQLPVAVFARLQTLDTLRLESCKLLQLPNNAFEGLTTLKALKLSTRNAEWGPAKALEL
YPDSLNGLKQLTELDLSDNNLRALPSGFLCPVGNLQTLNLTRNRIRTAEQLGFADMNCGA
NGGASGASGSGSGSSSGSELQLLDASYNELRSITESWGISRLRRLQHLNLQHNNISELSG
EALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQNNELYELPKGLFHRLEQLLVV
DLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHI
EDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLK
ELDLSSNQLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNHIGNIT
VGMFADLPRLSVLNLAKNRIQSIERGAFDKNYELEAIRLDRNFLSDINGVFATLVSLLWL
NLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPM
SIPNTIELLFINNNLIGNVLPNAFVDKANLARVDLYANQLSKLQLQQLRIAPVLAPKPLP
EFYLGGNPFECDCTMDWLQRINNLTTRQHPRVMDMPNIECVMPHARGAAVRPLSALRPQD
FLCRYESHCFALCHCCDFDACDCEMTCPHNCTCYHDQIWSTNVVDCGNQLTMELPRRVPM
DSSIVYLDGNNFPVLKNHAFIGRKNLKALYVNGSQVASIQNRTFASLATLQLLQLSDNRL
QTLHGYEFEQLSALKELYLQNNQLATIGNGTLAPLVSLELLRLDGNRLVTLPIWQLHATH
FGQRLRAIWLGRNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAAPNTAAYEQSSSTA
AGTQKRELDFNSTGAACTDYYSGGSMLQHGIPESYIPLLAAALALVFLLVVIIIVFVFRE
SLRIWLFAHYGVRVFGPRCEESEKLYDALLLHSAKDSEFVCQHLASELETGRPALRVCLQ
HRDLAHDATHYQLLEASRVSRRVVILLTRNFLQTEWSRCELRRSLHDALRGRPQKLVIIE
EPEVAFEAESDIELLPYLKTSAVHRIRRTDRHFWEKLRYALPVDYPTYRGNNYTLDHNHE
RIKQPASPGLLYRQAPPPAYCGPAEAAAAAAAAASVAAAEQNYSTATTATPSPRPQRRGE
RAEAVGVGVGVGVNPGGPHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPA
ATGAASAEVSQQRAQTWRPQPKQQQLQTPHAGTLNPSTAVKPNPQQQQQQASGQQQGPHV
QAYLV
Download sequence
Identical sequences B4KRL5
XP_002006506.1.58863 FBpp0170305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]