SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256323 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256323
Domain Number 1 Region: 52-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-47
Family SPRY domain 0.00043
Further Details:      
 
Weak hits

Sequence:  FBpp0256323
Domain Number - Region: 240-275
Classification Level Classification E-value
Superfamily SOCS box-like 0.000152
Family SOCS box-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256323   Gene: FBgn0229128   Transcript: FBtr0257831
Sequence length 303
Comment type=protein; loc=2L:complement(10485449..10485505,10485601..10485819,10485886..10486521); ID=FBpp0256323; name=Dyak\GE11313-PA; parent=FBgn0229128,FBtr0257831; dbxref=FlyBase:FBpp0256323,FlyBase_Annotation_IDs:GE11313-PA,GB_protein:EDW88395,REFSEQ:XP_002088683,FlyMine:FBpp0256323; MD5=2030f067d9b9a1ac42855109f3ed5263; length=303; release=r1.3; species=Dyak;
Sequence
MSDVEVDPQQAHPHPMVAIAPRRRRPGGRRGGGGVGGGLQTGTMDAATSSSPPPRFCPLA
EGVEDNWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRYYWELHVSQ
RVFGTSIMFGIGTKSARLHANAFRNMLGENEHGWGLSHKGVLWHKGVALLYTKRFRENQP
TQIGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFV
NLQDRCRAVIMRRVRSASQLEKLKLPLPIADYLREVIDEKEPLRQVNQLEMCIMNYDLYE
ARE
Download sequence
Identical sequences B4P3U4
XP_002088683.1.41174 FBpp0256323 7245.FBpp0256323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]