SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256333 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0256333
Domain Number - Region: 41-138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00691
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256333   Gene: FBgn0229138   Transcript: FBtr0257841
Sequence length 553
Comment type=protein; loc=v2_chr2L_random_010:504406..506067; ID=FBpp0256333; name=Dyak\GE11323-PA; parent=FBgn0229138,FBtr0257841; dbxref=FlyBase:FBpp0256333,FlyBase_Annotation_IDs:GE11323-PA,GB_protein:EDW99514,REFSEQ:XP_002086044,FlyMine:FBpp0256333; MD5=1133cdeeb01d55b146a99606041e1bd8; length=553; release=r1.3; species=Dyak;
Sequence
MAEESKFEVINLKGNEPLAQIQMGAARIIQTHKTLVHIVRLQEYKQIIEGIEITLKKIVD
EPETRDLVKSLQNKLQVTRNRLESIWPRHRRARELINGLGSVVKAITGNLDANDAEKLEE
EIRKMREREENLRENINAQEGTGNKINVMFRNLTKYINEEQSRVNTFINNYNNGISKSLV
EEDRRIYRLEYINRISLTIDILGINLNDVAESLLLAKLGIISKFLFNKQETDKCVKELER
QEIQLVSDEHMYEFLELNEIMNNTDILFSIRLPLFKKEIFSLTRLIPLPMNNTEFVITPN
YVAIHGNEIHYYKNKCLFLRNIFICKYDKIVSQENEKCITRLLSGKESECTTKDIGFITT
IFEPEAGYIAIFNGENIKIHTDCGFEKTINGSVLIRFNHCKTLINNVQYEAAERLGTASL
ELDIPHIQKIRKNKTTQELGIHELKMEDLETKIQINRIQWGTTIHNTTPYTMLGVLMVLI
LLVPQEDKDILAEYHTPWHLHTHHRSSGYHSINSPAMFGSSDWGGGGVTASEVTLGGPQS
KAASTTGERETGE
Download sequence
Identical sequences FBpp0256333 7245.FBpp0256333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]