SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256356 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256356
Domain Number 1 Region: 247-390,417-518
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-71
Family Calponin-homology domain, CH-domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 3755-3911
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-20
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 4398-4553
Classification Level Classification E-value
Superfamily Spectrin repeat 3.55e-20
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 4 Region: 6724-6880
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 3330-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-19
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 5264-5419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000226
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 2699-2838
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000267
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 8 Region: 7033-7147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000295
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 5903-6020
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000425
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 10 Region: 6048-6171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000396
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 3119-3238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000525
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 12 Region: 5628-5747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000972
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 13 Region: 1287-1440
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000108
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 4829-4953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000134
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 5045-5179
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000302
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 16 Region: 6502-6653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000439
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 17 Region: 5479-5598
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000103
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 18 Region: 2907-3054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000012
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 19 Region: 977-1136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000244
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 20 Region: 3972-4095
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000298
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 21 Region: 4235-4348
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000312
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 22 Region: 7351-7510
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number 23 Region: 777-914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000419
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 24 Region: 3545-3691
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000017
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 25 Region: 1951-2092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000605
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 26 Region: 1850-1947
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000772
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 27 Region: 4557-4670
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000843
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 28 Region: 1418-1552
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000916
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 29 Region: 7247-7400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000136
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 30 Region: 7670-7806
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000195
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 31 Region: 4098-4218
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000403
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 32 Region: 2258-2408
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000662
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 33 Region: 2475-2626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000484
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 1769-1880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000173
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 35 Region: 5184-5277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000198
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 36 Region: 6850-6944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000275
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 37 Region: 922-1005
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000302
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 38 Region: 2171-2301
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000414
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 39 Region: 1133-1237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000916
Family Spectrin repeat 0.006
Further Details:      
 
Weak hits

Sequence:  FBpp0256356
Domain Number - Region: 5743-5850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000302
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number - Region: 7159-7236
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000331
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 1527-1620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000432
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 7903-8009
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00101
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 4957-5039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00403
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 3241-3319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00412
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 6161-6267
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00547
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 4744-4837
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00672
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 628-715
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00877
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number - Region: 6953-7047
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0109
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 3666-3746
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0137
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1662-1780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 7819-7934
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0978
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256356   Gene: FBgn0229160   Transcript: FBtr0257864
Sequence length 8015
Comment type=protein; loc=2L:complement(10366317..10366427,10368422..10368682,10368737..10368949,10369052..10370021,10375390..10375541,10377017..10377322,10379550..10382332,10382444..10382681,10382810..10383016,10383406..10384548,10384650..10384964,10385307..10398494,10398677..10401283,10401402..10401642,10401710..10401876,10402371..10402643,10406653..10406714,10420555..10421365); ID=FBpp0256356; name=Dyak\GE11346-PA; parent=FBgn0229160,FBtr0257864; dbxref=FlyBase:FBpp0256356,FlyBase_Annotation_IDs:GE11346-PA,GB_protein:EDW88378,REFSEQ:XP_002088666,FlyMine:FBpp0256356; MD5=d5c4fd36db362406896d740283dbeb9b; length=8015; release=r1.3; species=Dyak;
Sequence
MSGQQPPPYGNGPRGWNPRAHNPASPSPSSFLYRPPSPWTTAPSPPPIISGPRPYGHAMS
PAPINQVRGQRGSTNIPHPRPQWPGGNQSPSPYQQPAPGGGYYGGVASSGGASPAPRPYR
PAPLQHQNSYGAQPTSSFQLSPTPSPIVCQTPSSDFNYSNRQTPLSHHQYQQQPPQFYHQ
QQQQQQQGAPVIPPQPRQHGGQGGYGGHGLAQDQIDFVGVPLEPPQPKSYVIYDDEEEFG
PSTAEIIANQSQDYVDEKLAEYQMTILQLQEEQERVQKKTFTNWINSYLLKRVPPLRIDD
LINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPA
DLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKW
KQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNR
QRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYGASRDQSHVQQEADELRRFLVE
KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEIN
ELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLLMDNDIPNSMNEETAAVISRKL
EEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEH
KCCLIAFLNLVENKMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE
EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEE
WLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALS
ERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKQYG
QQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRIRAQLPAK
LHLFHQLQIQQESLEAGQKEIHQWLSEAEQLLGTHNLSGGRDAINEQLHKHKTYFSRTVY
YRSMLESKNKVFQNLLKAVSSDDKIDTAPATQQMQQLNERFNYVIQNAQQWEQRLDSAAG
GWSNFKDNERVVSEWLTQAESMLVEKHIESKTTIETQKYFFEQVNDRWMNDLVQSAQQLL
TTLPAQEQPAVVHSVEQLQSRWKNVLSQAPLHLLKLEFRLDENAFYQSLKDVEKELQLEQ
QALNRNEDVDSILQRNQQFLLQQDVVPRLERCLQNMQRLAQAHRQQQPGDISLDQAYDNA
KSQWQLLSNKLGDMRQTLQQIPAQWQGYHLKFNDMVDWMNGVDQSLKNIVNEVNTMEEFE
KEKVVFQKICQDADNKREDMKWLVKTLDSLLSYATEDEANLEQKKLEDLIARYKNLIPTI
EITMVKTEVFSKCYTYRREVHEVVCLLSKVKDQTANIPAPDSLERVNRLIEEQQYAVNQL
DHQRPHIMSMLQRGRDLIKDVHAPAFVNAEVKNLETGWNQAYTETSDKLQALKGTQAVWS
EFVDQKNDIFSMLQTAETELRSLTPLQTDPKNVSQDLKSKRDLNVQLQQASHQLLPKLHA
LKSELAPLAAADKRPILEKEVTEVEKMFFNTMEHVKDRVGYLEDYSAKWNNYKTRLAELQ
EWANKVAPKNIEALQSEDLTPEERVVKVQAFKRILGDRMKQLDLLAADASELAPKEGNIA
EAKRLKGEITKLQEVLSAINRNVDHQAQAVQEDLVNWQQFQAGLQQIKPAVEQSEVKVNN
VVSKPISLEEAVAMQQNAQQFETQCQEQLDKLHGISNISHKMLCKTNAPDELDAMHSRWT
AVHENAKQASAKLEKLVANWKSFDADAAKLEDWVGQGEQLMSRRPAVLNTPHIDKLEKEL
VKLKSFNNEISQQQAKLVTLGQNADQISLHLAPEGAAALKDRVYQMKGKLQKLSEATRGH
INEVSDAIISRQDFNAKLVNFSNWMEQLRNQVTQVEEINPERVETSLHVIHALLQEHADK
KPSFNAIYDEVKQLALGATPEESNALNDAYTALVVNYQNLETNMLQKKAALEKWTELLGW
KNDTESHLNYLKHQLDKPEGPAAEELSKVIDEIDNLGQGIGYWKGQAKEIDENPAIQLRD
ALSRRPLIATQIVNDVENKLENLKLRSQNQQQQIQQMTVRKDKFHALEHNFGQALQENRA
KLDEILRQHPTLNNIDQIIADLVALNDALKYQADLKNRIHDEGSLLMREDIASMPAIQES
LLIMDKNYDSLQNEIADRIQKYNLISQALREYADSKDKFTKELQKAEDLFNAIPQQPRDE
TELHQASEKTRKTMEQLRKSKLSLDELERRGNNVGKLFSAIGEPIPQEVPQEVTAAKQHW
QDLHDKTAKNAHVYETEAVIWSQIEDAKKDLLPWLSETNQGLCDAADNSIEIEFGPMRLS
KYRTELPSYQALKDSIVEKTNDLVKINKGAEIPALSALNKLLSEQFAEVSNNADRLSAIT
TSFNDQEQELRRRSKEAGEKVSKLREQLIKCDDMSGDNNKIMERLLQCRALRGELDNSGN
EIDNIKQKVDELRNLYPTFSESIIPKELNNVQKRYENVDLYAKKIESSLLQFLKKFHADK
VGMLKRIIATQREKVAWCQPESSSDKYNLDVKKSSLQEVSKSIDDCKARHAETLKSLEML
KAVESPQNLAELTSDAELLRKDMQALQDSFDKIKGILDENVDLWSQYEQSNEQISNWLRD
VEGRVKAETSSQVNLSEVPQKLQELSLLQQDVLAHEPIINNLEQTSQQLIEKNPEARIGQ
FVTHLVQRYQAVSKALTSYIDKIRSAQLSNANFAKAAKDFNEWFGDAKIEFQELARMGSP
GSSSATAQQLQTVKNYIKTFDNGQILLNNAVDIGEALYPVVSPDNRERIRADLRQMREKF
DYLRDEANAFMQQVEGVLIQKTSIEESYTQVSHYLNESKAKVPTGDELYPTLATKKAALQ
NYKTQLQEITLHKNALKQLHDKAVTLCDDESERKTDESIQEYNTLSKKISDRITTVGNHV
VKHEAYDQVLEKAQDWLNTIKSEAIDILNETTFEKEGAEEKLLVVENLLQHKPEGDSIFD
TCQTLLETVLTQTHPSGHPALLKGFEEPKQSWEDFMTLCQDSLVKLKQLCSKWDEFDTII
EELDNWMKNVEAVVKNQNLKSTAEAKNAHLKQLQDISKDIERRGVAINELMDQGREIEGE
TDLNLKLSRLNTRYQTLKNLCKESIAKYVNYVKDHESFDKDFDAFKQSLQSSVDELAKTN
EIVGDQSVLQDQQNKLREMSDKRISDSTLFEGLIDRGEKLYGHTSPEGREIIRQQLRALR
TLWDNYTDDLNSATQKIDQCLLQFNEFSIAQDQLTKWLKDVDKAMQSHTEPKTTLQEKRA
QLQNHKLLHQEITTHNVLVDNVCDKAQILVDQIKDNSLNVYLTSIKQLFQSIVQKSDEIL
HNLEDCVQKHNELNNALASAKTWISNEKAKLLECDDAYGEKADIKRKIETLGQLAQNKPQ
AMKIISDIRDLFEKVKATTSEKGNEVLEKEIEELETTMKSHFDDIEGIEGKQKDVLAQWD
KFEKALEELTKWCRSAEAVFREQQLQSTLHEKVEQLEKYKIQRELILQKEKEIDAFGDAA
HALLNNCGADRLKTLTTQITNRYQLLQVLSKEVVNRWSNLVDDHQFYQDKFNEVDLWLQP
IESQMAKVLLDEPTQSSNILQVLLSEKEQAESLFAALNAAGEKALPETSTQGREKIRKDL
RDIRDRWDKLDEGIRNLEKRQEAQGVQLSSYQDILNQTVNWLDQVEKLLHNENPASWTSA
QEIRSKLYKYKATNQDINSHKRIVEAVNEKAAALLGSAAPANADEISKAVAEVNRRYEQV
GQDCAKLVADLDGAFDVYQQFSELQKAQQDYQKNLWDRLTGYSDYSGNKAALQARLQKIN
EIQDALPEGVAKLKSLEEHIEQQASNIPARSKEAMARDLANLHADFEKFGASLSDVKSGL
ENRLQQWNDYEINLDRLITWLGEAENALKNYNLKSSFEEKEEQLNGFQSLAQNLRQNEAD
FDKVKDDTSELVQSSGETRIAVNVQQVSSRFQSIQATAKEILKKCEQAVQDHGHFNDKYK
QCADWLANAQARYDDCCDLSTVASRDDLLKKQMVIQELLAQQPTATQLLNSTVEQGEKCY
GSTATEGREAIRSQLDDLTFDQLFDNIAITARKIQDKIAKWSGFDEIADSLKSWLDETEN
ALPADIELKTTLDEKRNKLQTYRDILNDINNHQVELGNLQEIAANLPEKTDLVDEILKDI
SDRFGKLQKRAQNYVERYEGIVSAHQQYSKAVMDAQEFIDATLNTVHYWGDLDLEQISLH
TNLDRLKNLKASLADEFPRVDQVRALGEKVIPGTVDVGQVNIKSQIDTTQQEWESLLTTI
SSTIEAIEARLQHWSEYEQLRDQCLAWIRDTDNNLHAIDLKEDLPKKRAQLDALKALQGD
VRAKELEVDNVTEKAQTLLKGPSSNRASGPELVTKYQQIFHKVKELNNRWQQYVTSHEDF
DNAISDCSSWINDIKEKLDYCSDMSSMSPKELDKKLATIQDVILLKDEGSARVLKILEQA
QHVLANTAPGGHEAINKELTDLQELWSGIALRIMDVKSNLDDSITQWSGFLDQVQNVRKF
NEWLDGQVKELSEHQTTMTEKRAQLDRVKSTEEKVRVEKIDVDALKIQAKEMIASGQQSQ
AAFQAQKVLDTFDELFAKTQKLLSDRQDQYRDHRLFKEAYDDLVSWIGRAREKFPSLKQS
SLSDKLAIENAVQATEALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRD
SFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPDKEK
QVADMKDVMSRLEKGKDDIDKFKASAASLLKSHLDTYVNNQLRHLSSVYQVQVNLAKDVL
KKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAGSKEALQRRLEQIQDLIRNREL
GQNLVHTAINNGEKIIRNTRSDGRDAINSEMKELQTEWDRLVKKMSTAKVQLETNLLQWA
DYSSSYSQLQQWITDREAKLQQACEQKIVKSKRGQPGLSSGLSERKANLRQTNNIVQDIV
SFEPMIQSVTSKASVLQQGAPGTEISDKYENLTKQAKDLYEKQKNTIESYQSLIDAGNEF
ATWLRNAKERLSKCSEPTGDKQALAEKTHQLKILQGELPEGAQKLKNALEQGEIACRSAE
PEDCEIIEQEVALLQEEFDAYREALNKAKDYLEVGIVKWSDYQDQYTEALEWLSKTEALV
QSYNKLQDSLIQKKVVLEQFQGHLQTLFDWQKTLDDLNMKAQVLLETCSDTRISNAIMQL
TTKYNALLTLAKEVMRRLEMHYQEHQQHHSLYEECQSWIEKTREKLSECEQIPGTLNEVQ
IKLNTVKNLRQGFETGQNKLRYLLELKEKVIMNTEQNGAAKIQEDTEALKQDFDKLLVDL
NDVRQKLANRLAQLEEIFKLYKILVEWLEDVEPSVKTSNEFLNDLSEKRAALEKFRVIQR
DINGHNDIVEKINQRLKEDNSLDLKDFQPGLTKFDDLQTQVNKIIESLENQVNSHEKYKQ
AYNELQDWLRRTRIEVEQCADCHGEKEQVESRLNRLGDIQSSSLEGKALLEACEELSQAV
IATSGSEGQDNVAQEIKHLTSEWETLQSLSRDARSSLESCLAAWQTFLQKFNKINLWIET
MNKRVTKSQEGENKTPEDLVNAKKLLEEVLAEKDNVEDLNDNCELLMEQSACTRIRDQTI
ETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQTVLDDCSTDGDAAII
AQKLDTVNSLASRLPEGQHLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLA
VKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETTLKVAPETKGELSEMKTLLERYKTLS
NELKQKGNELEQLQSEARDLGTEVDAVNRLQSRCDKLKNDCSAHIAALEQEMFDYNAYHQ
SLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNLDDLNAKGQA
QIKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDSIMR
NLETYEPIIQTELDAPATSLELAQNQLRCAQEMQNKLNNEKSRLAAAVQACEAATASISR
PSSPLETAMQAIPERELIVRAKLEDLLDQKPPPKTRSSTKGVNRDDDEDEDDVEIQVELS
DVNEALLDPIAHERVRNYRRIVRLNSAHVGKLNELVAKVQSHLGGLTASVSELEQQQKQR
AELQDWVKKQQSSISDWMMRPCKLRPEAAQQELVSMNDLLNSIGDKRSQLMLEMTGSLGD
EDTDLDDNIDKLESELMDAIAKKQAGQNVIDGYRQGMADVQNWFDTLIKRMDVLDRGSGL
NCAQKMAAINEIKNEYELQGHPKIQELKGKAAQVAEVISNLDGQQVEEQMKSLDRRFADL
GKRIDRKAQLLDVTNKGVEGAKGEIDQLQNWVKQQIEELQAPTPLGYTPKDAEARQQKIK
SLMKDAEAKQSLADVLEKRVANMQQELEPVEYSQLESALRNLNTENRNLSGVLKAELDRA
LEASKARKTLENDLDKARQWLKTKISEVRKLPVYHPLTSAEIEKKIQENRKYDDDAKQFN
DSVLTDVQRQAANIMKDCDDADKAALQQILDEIAADYQTLKDESSKRGKSLDDLLQGRKA
FEDSMKNMGDWLNEMETATEGELRTTSLPVLEEQLAHYKKLLSDAENKGGLINDVSEQGK
SILPTLSNADKLKLNDDIKNMKDRYGRIKNTIDDRVNALGDHIKKYKDAKSRLAECSQFL
GNIQQKLRELNRPIGSRIEDVQDLLGAYEGILKELKDSKSKMGDMQIDDLPELQSILAQQ
DDMIKLIEDQLAHLRQLLLLREQFIALINEIIAFIMKYTDVIIDIENSPDSLEDKINKYD
DVIVKIQECEGVLASANDKGQKIASEGNAADKNSITEQLQSLKNQLQNLRKAVESQRQKH
QLQLESHKKMAAELSDILDWLHSHEGAAKSRPLLDRDPESVERELQKHQGLSQDIESYLN
KFNKINHGVKTEIGMPSSLLEMLSEGRSLVASLPHELEEREKYLKNNRDSRLEYMQLVAK
FNDWVHEAELRLQNSQHGIDYEHLVQDLDEHKIFFGNEAPIRNLVHKQIQEAADKIWSSL
NNYEQSELSAELAQFQTKLTNTLANAKTQQSELEKEAERWREYQQSIDRVKATIERTKFV
DEPVQNLAGLHFNIQKLSHAIGNVQSQNSDLTLVNQQAQSLIRQADARNRQLIEQDNAGL
NRSWQDLVRSLEQRRDNLQQLAEHWDGFENSLHAWEKALGRLEDKFRNVDPTVRSRRHLE
DTKNAIQELREESNQLKSSHKEIEALSKSILTFLGEVHKPSAEAIQAKVDKLVEQQAKLN
DTLRDKEQQVSKDLEEIEQVFRRISQLQDKLNALHDQLQSVHVYDEHIAQTEQLLITLNS
QVQQAAEESKSLVAQTTAHYQAKQNQLPSDIAQEFTALELLAERVQVTMETKEKDFKRAK
TVRTEYVAGVDEVQRWLFQAEVQVQERSLTPTQMKELLQRINHEITAIYERFTLVKTNGQ
LIIENCRNSEEKTLVQTTIDQLAASLAQVRGWLDEKKQAVGDSLDAWTRFMNLYQIVMSW
ASEKRTFIDQTIELRTLPEARNKLNDYVTAVKSIKPIVKHLSEMDKELEHIGQVTTVGDL
KDKLQEAEDAKISVEAVLLERNSLLQEACEEWDQCERKIKDIRSWHEKTKQGLDSSQQQK
KPLRDQLGFCEKTLADINVQKTKLRLSIEKLEVHFRNGMGGDPRLSENVDDLVRVLDGLG
ELVRAKSQSLEQTLAQIDVYQQQMQSLRQRIIQEEQQLRLVMAPTYLPHDRERALAEQQA
CRERVKNLHSKITARNERIKLLIHRGTPDDAKLEI
Download sequence
Identical sequences FBpp0256356 7245.FBpp0256356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]