SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256358 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256358
Domain Number 1 Region: 104-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-67
Family SPRY domain 0.00000000108
Further Details:      
 
Weak hits

Sequence:  FBpp0256358
Domain Number - Region: 307-347
Classification Level Classification E-value
Superfamily SOCS box-like 0.000262
Family SOCS box-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256358   Gene: FBgn0067966   Transcript: FBtr0257866
Sequence length 349
Comment type=protein; loc=v2_chr2L_random_028:join(806008..806027,806353..807242,819475..819614); ID=FBpp0256358; name=Dyak\gus-PA; parent=FBgn0067966,FBtr0257866; dbxref=FlyBase:FBpp0256358,FlyBase_Annotation_IDs:GE11348-PA,GB_protein:EDW99541,REFSEQ:XP_002086071,FlyMine:FBpp0256358; MD5=aced4dd227080023738dc01e51f0f4fc; length=349; release=r1.3; species=Dyak;
Sequence
MEFGKKRYKGGRTPSIRSSERRRPQSVSSISTLSPRVVLSRLEPREFERLRLSYKVAIDQ
RRSRSCRGMNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASR
DLQLRHSWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQ
RGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKND
EAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPVVSAVWGHCEITMRYIG
GLDPEPLPLMDLCRRTIRQKIGRTNLEERIQQLQLPLSMKTYLLYKNRR
Download sequence
Identical sequences B4ISV9
7245.FBpp0256358 XP_002086071.1.41174 FBpp0256358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]