SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256455 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256455
Domain Number 1 Region: 672-817
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000357
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  FBpp0256455
Domain Number - Region: 559-644
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256455   Gene: FBgn0229250   Transcript: FBtr0257963
Sequence length 1007
Comment type=protein; loc=2R:complement(20366309..20366662,20366720..20367016,20367077..20369376,20370727..20370799); ID=FBpp0256455; name=Dyak\GE11445-PA; parent=FBgn0229250,FBtr0257963; dbxref=FlyBase:FBpp0256455,FlyBase_Annotation_IDs:GE11445-PA,GB_protein:EDW92549,REFSEQ:XP_002092837,FlyMine:FBpp0256455; MD5=192b716696ae6470ebd657d5cd076a09; length=1007; release=r1.3; species=Dyak;
Sequence
MNALLRHKGRNLRTSHLAQNVYKRFLKSNCCACSSVNFTDEPAKEVGRPRRSASTSVLEL
SRRFQPPASYGYHYSGYGFRHLHTSRTMLETSSSKIDATVKKLKNQQKEKVEEIMKEVAN
GQAAAVRASSAATATASSEKGQNASAIAGSTSATATTTTLAKPVDKSVAKPKKPLRTRIW
DELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIV
PFMELLLPVFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHKEH
SSEEAKQFEAFFTKIRNPTESVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTI
GTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQL
KEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETMRVLPDAVGAHTRHAIGESEGK
VDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEEIPAPYVFAEKLARSKDLLDHKE
QPTVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKETIKELKEELADYKEDVEELREVR
QVVKEPVRESRAAKLLYNRVNKMISQLDNVLNDLEARQHQIKQAESSDNAASSPAAEPQQ
MVHIDELVATIRRMKEASDEERFKVVGDLLVKLDADKDGVISVNEITKAVQSIDREATNI
DKKQLEEFTELLSKLAARRRHEEIVHIDDLMSNIKVLKETSDEARLKHIEAVLEKFDADK
DGVVTVNDIRKVLESIGRDNIKLSDKAIEELITLLDKEQVLQAEQKIEKAIAKSMKEAEK
LKSEVDKADKDLSKLVNDIHDSAKEIQDIANEMRDKEETLPDKAKELKAEPAFKDTAKTL
KDNAKNLDDLATNPKPDPKSPTKASTGSSPTGISGGGPNSGGSGFASGSTTESALREAAE
RQMEKILPSTDLGLPPTIQTPSQPPTSKKATATASTLSTTITAKKLL
Download sequence
Identical sequences B4PBB7
XP_002092837.1.41174 XP_015051675.1.41174 XP_015051676.1.41174 7245.FBpp0256455 FBpp0256455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]