SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0258841 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0258841
Domain Number 1 Region: 51-158
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000157
Family Insect pheromone/odorant-binding proteins 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0258841   Gene: FBgn0231479   Transcript: FBtr0260349
Sequence length 208
Comment type=protein; loc=2R:join(13583756..13583824,13583997..13584221,13584303..13584635); ID=FBpp0258841; name=Dyak\GE13831-PA; parent=FBgn0231479,FBtr0260349; dbxref=FlyBase:FBpp0258841,FlyBase_Annotation_IDs:GE13831-PA,GB_protein:EDW91460,REFSEQ:XP_002091748,FlyMine:FBpp0258841; MD5=4529269bd79929d05b0e2967da987817; length=208; release=r1.3; species=Dyak;
Sequence
MYFRASLLALLCLTLTEFVSQAWTRSLTVSLNMSMTRTLVPDPPNGTETKLSQEMLRACM
RRTEISMSQLKLFHMSLMNSDYNNDNDIAPTPVQSIGDCFVSCLYESLDLDRYNVLLEEA
FKNQVQTIIQHEKSEIKECSDLQGKTRCEAAYKLHVCYNHLKTLEAEQRIREILERTEAE
NEEFGPDGSDFIDGIQHSGEAITSTKPE
Download sequence
Identical sequences FBpp0258841 7245.FBpp0258841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]