SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0258992 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0258992
Domain Number - Region: 21-65
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00935
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0258992   Gene: FBgn0231617   Transcript: FBtr0260500
Sequence length 82
Comment type=protein; loc=2R:15712096..15712344; ID=FBpp0258992; name=Dyak\GE13982-PA; parent=FBgn0231617,FBtr0260500; dbxref=FlyBase:FBpp0258992,FlyBase_Annotation_IDs:GE13982-PA,GB_protein:EDW91772,REFSEQ:XP_002092060,FlyMine:FBpp0258992; MD5=f3de23c8eeabe681e27800e04256cf50; length=82; release=r1.3; species=Dyak;
Sequence
MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSHHEELQRAIRE
HHAQHDAKMMRAMEEAEGKQQK
Download sequence
Identical sequences B4P5E1
7245.FBpp0258992 FBpp0258992 XP_002092060.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]