SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0260375 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0260375
Domain Number - Region: 108-173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.018
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 199-285
Classification Level Classification E-value
Superfamily GAT-like domain 0.0863
Family GAT domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0260375   Gene: FBgn0232945   Transcript: FBtr0261883
Sequence length 612
Comment type=protein; loc=X:complement(19321255..19323093); ID=FBpp0260375; name=Dyak\GE15365-PA; parent=FBgn0232945,FBtr0261883; dbxref=FlyBase:FBpp0260375,FlyBase_Annotation_IDs:GE15365-PA,GB_protein:EDX02979,REFSEQ:XP_002101871,FlyMine:FBpp0260375; MD5=aaea934492dd50b9ed32c5f6654601f8; length=612; release=r1.3; species=Dyak;
Sequence
MKFSEHKARILALTANHVDELQAMWTRMFEPQTCEDCIVRLEAHAHSFYTDIINESRDKE
ETINSDIAALRTEATDLKRLLHKAVDIGQRPDDVPLSIWYMKLDTSIDHLREELAGRRAE
ISELLQQQQQLCDELGELPHPLLADPLPLPEEMDSFRDHLAQLRDQRVQRLKEMDQLRHS
IRHNMKLLEIHLQTDSEKQLLNSDTHRLTPESYERLQTMHKEYADQVQELRERIDGMRDK
VDLLWQRLRLTDEYAMRRVRESTSYNQRTFDILREELERCQAMRQQNIKTFIDQLRIEIN
EWWDLTLKSTKERRRFTSYYCDTQSEDVLELFERELDHLKEFYNSNRRIFELYSTRGELW
SRMEALEAKANDPNRFNNRGGQLLKEEKERKTMMSRLPKIDQQITELVKVYMSQANTPFL
VHGEDILNSMSTDWERHHQSKKQPSAQKKDTNNASIKMKPPMAPLTPNTMKGNRGIHGSS
SSLKKTPSKLNASTTAKSTGNLQKRRHPNHGRNSPQPAAAAKRNLITSLECNNSVPMIGV
SNGQKPIKSPQKKVRVLEYSVRRGKASGRPSTGNRNPQRNRPIPQIHVRPPSGEENESPD
EESGDLEAFAAY
Download sequence
Identical sequences B4PY07
7245.FBpp0260375 FBpp0260375 XP_002101871.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]