The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0261023 |
| Domain Number - |
Region: 18-35 |
| Classification Level |
Classification |
E-value |
| Superfamily |
beta-sandwich domain of Sec23/24 |
0.0131 |
| Family |
beta-sandwich domain of Sec23/24 |
0.048 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Molecular Function |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0261023 Gene: FBgn0233565 Transcript: FBtr0262531 |
| Sequence length |
342 |
| Comment |
type=protein; loc=X:complement(9935861..9935925,9936039..9936203,9936598..9936706,9937120..9937809); ID=FBpp0261023; name=Dyak\GE16013-PA; parent=FBgn0233565,FBtr0262531; dbxref=FlyBase:FBpp0261023,FlyBase_Annotation_IDs:GE16013-PA,GB_protein:EDX01843,REFSEQ:XP_002100735,FlyMine:FBpp0261023; MD5=5fb8f0cdcac1a434b34ba2b51c98dfbc; length=342; release=r1.3; species=Dyak; |
| Sequence |
MSVTSSIEKPKTTATAIQQQQQYQQQQQKPQQQQQDKSSSSSSSSSIAIAAAAGQQQKRK
SLSSKRSYSLSSSSASSSGSFGAIRSATSPLVTTAEREKDKEKEKSSSSASNSHHPHHHH
QQQHQQQSHLPFSYCTDTIAAVHHQRQSYALVQKPPSLRCQGKPHHQLSNFSPTMTSSEP
SSPLAADGSGSGILSPSEVASHCCANVKAKITTPLATTTHKMHRTIPSDKINLRLILVSG
KTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVTLGALGLP
LGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRCCSTNCSIL
|
| Download sequence |
 |
| Identical sequences |
B4PX80
XP_002100735.1.41174 XP_015045923.1.41174 FBpp0261023 7245.FBpp0261023 |
