SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0261224 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0261224
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-39
Family G proteins 0.0000253
Further Details:      
 
Domain Number 2 Region: 181-219
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000196
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0261224   Gene: FBgn0233755   Transcript: FBtr0262732
Sequence length 252
Comment type=protein; loc=X:complement(6629764..6629981,6630347..6630569,6630814..6631007,6631093..6631216); ID=FBpp0261224; name=Dyak\GE16214-PA; parent=FBgn0233755,FBtr0262732; dbxref=FlyBase:FBpp0261224,FlyBase_Annotation_IDs:GE16214-PA,GB_protein:EDX01466,REFSEQ:XP_002100358; MD5=64dc4de8472a1ad14f4ef9e29d0dc93d; length=252; release=r1.3; species=Dyak;
Sequence
MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNAYKTTTILLEGKRVKLQLW
DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGNRL
HLAFKRQVAAKQAETYASRNNMSCFEISPLCDFNIRESFCELARMALHRNGMEHIWRSNK
VLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFNSLTQSSKSKNRCKT
PTSSSRNSCAIA
Download sequence
Identical sequences B4IGF9 B4NTP8
FBpp0193028 FBpp0261224 XP_002042819.1.34323 FBpp0223064 7245.FBpp0261224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]