SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0263712 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0263712
Domain Number 1 Region: 47-70,138-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.81e-55
Family Ankyrin repeat 0.00014
Further Details:      
 
Weak hits

Sequence:  FBpp0263712
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00657
Family Ankyrin repeat 0.0071
Further Details:      
 
Domain Number - Region: 516-575
Classification Level Classification E-value
Superfamily SOCS box-like 0.0174
Family SOCS box-like 0.01
Further Details:      
 
Domain Number - Region: 429-459
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0181
Family Ankyrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0263712   Gene: FBgn0236099   Transcript: FBtr0265220
Sequence length 600
Comment type=protein; loc=2L:join(10474787..10475006,10475629..10476855,10476935..10477290); ID=FBpp0263712; name=Dyak\GE18702-PA; parent=FBgn0236099,FBtr0265220; dbxref=FlyBase:FBpp0263712,FlyBase_Annotation_IDs:GE18702-PA,GB_protein:EDW88391,REFSEQ:XP_002088679,FlyMine:FBpp0263712; MD5=6a43136bed8ea34867968bac48e35498; length=600; release=r1.3; species=Dyak;
Sequence
MLSYDLNERLLTAVQSGDFEQALGCIMQGAQASYVSPTCGRTAVGTAAILGDAELLELLL
QSCEEPELDVFHQSKTDSLEIERTPEGMEKLEWVDEFENCSENGAGSGEEDSQLYQYYAK
TFETTGEFISSQCCVSCREQDPHLYDAELATPLHYAACWGHEECVRILLEHNAPINVVNS
EGYAPLHVGAGFAGVTKLLIKHGALVNAKTLGDGKTALHVAIESKSAESARLLLQTNINI
NDTDDDGETPLMTAIACSLLDVAQELVKRGARINLQDKQNHTALQYAVRGRHCQMAKLLL
ERGARRLASQHLLHLAVESNDRELVELLLQYGESLSVRDADNYTPIMLTIHLGRHEMLEY
LLSVAEEHRKLGLYSDVHDEGLVLFAVQQNVWVKEFSRILRVLLAKLPSARKDFYGSCAP
TIVCGLLYCQTPLSRAINLHRLEVAEFLIHEGCNLAQICREHVVNELRSNCTPTRLAFAR
LLCNAGFQFPHKHRPLPKDWPPARQEFEREMCLFGTQPRSLQSLARLEIRRSLLRSLRTR
PEVQDMYCPTQERSSLGRIVDEFAIPATLKRYLSDFAELPAVRGMEPVEIPVIRCTESWD
Download sequence
Identical sequences B4P3U0
FBpp0263712 7245.FBpp0263712 XP_002088679.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]