SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265016 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265016
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily POZ domain 1.05e-24
Family BTB/POZ domain 0.0071
Further Details:      
 
Weak hits

Sequence:  FBpp0265016
Domain Number - Region: 336-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family Classic zinc finger, C2H2 0.00089
Further Details:      
 
Domain Number - Region: 420-474
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265016   Gene: FBgn0237331   Transcript: FBtr0266524
Sequence length 558
Comment type=protein; loc=3L:complement(14829908..14829970,14831514..14831995,14833539..14833676,14833832..14834167,14834276..14834741,14837326..14837517); ID=FBpp0265016; name=Dyak\GE20006-PA; parent=FBgn0237331,FBtr0266524; dbxref=FlyBase:FBpp0265016,FlyBase_Annotation_IDs:GE20006-PA,GB_protein:EDW94522,REFSEQ:XP_002094810,FlyMine:FBpp0265016; MD5=9a3ca9ec936acd516a1063f027ae4f09; length=558; release=r1.3; species=Dyak;
Sequence
MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLL
DLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQ
TVTKDDYTTHSIQLQHMIPQHHDQDQLIATIATAPQQTVHAQVVEDIHHQGQILQATTQT
NAAGQQQTIVTTDAAKHDQAVIQAFLPARKRKPRVKKMSPTAPKISKVEGMETIMGTPTS
SHGSGSVQQVLGENGAEGQLLSSTPIIKSEGQKVETIVTMDPNNMIPVTSANAATGEITT
AQGATGSSGGNTTSGLSTPKAKRAKHPPGSEKPRSRSQSEQPATCPICYAVIRQSRNLRR
HLELRHFAKPGVKKEKKTISGKKSSSGSSGSGSGALSTTGSVPQVQTVQSLHTLQGVQVK
KDPDAQQQQQQQQQQQQQQAMTVSGATGGQVQQQVQQVQQQVQQQQQQQLQHHQIIDSSG
NITTATTSAQAAAAAQQQAAGQQQQLVAQSDGSESGAPLSIAQVQTLQGHQIIGNLNQGN
NKNILVKKVFILKGGNNT
Download sequence
Identical sequences A0A0R1E2W0
XP_015050459.1.41174 7245.FBpp0265016 FBpp0265016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]