SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265170 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265170
Domain Number 1 Region: 198-259
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 4.97e-16
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 30-86
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000115
Family Tachycitin 0.025
Further Details:      
 
Domain Number 3 Region: 127-186
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000288
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265170   Gene: FBgn0237482   Transcript: FBtr0266678
Sequence length 281
Comment type=protein; loc=3L:complement(11991808..11992587,11992643..11992708); ID=FBpp0265170; name=Dyak\GE20160-PA; parent=FBgn0237482,FBtr0266678; dbxref=FlyBase:FBpp0265170,FlyBase_Annotation_IDs:GE20160-PA,GB_protein:EDW94230,REFSEQ:XP_002094518,FlyMine:FBpp0265170; MD5=99015b24f7971e5cf9168b5597788556; length=281; release=r1.3; species=Dyak;
Sequence
MKLFGLLCGMLVLHESTLAVLQNGFAFKTSHCEGKNGGLLPMFGSCKGYYVCADGNAVTG
TCEKNTLFNPLTLHCDDPDNVDCIFDGKDNVGDDTSSSESDEDDEDEVPKTDPPTTVKPT
KKPRPTIQDGMCAGKKDGVMLARTGSCQEYYVCKAKKPHLRSCPGKQHFSPTRRICMKPS
EAKCSKGSQENKELDSPATTGGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLH
FNTASSRCDYPKIAKCQTKRNESKGKSKSRKPVRKAKKLRF
Download sequence
Identical sequences B4PG66
FBpp0265170 7245.FBpp0265170 XP_002094518.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]