SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265672 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265672
Domain Number 1 Region: 101-148
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000137
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  FBpp0265672
Domain Number - Region: 6-98
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0151
Family Spectrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265672   Gene: FBgn0237967   Transcript: FBtr0267180
Sequence length 164
Comment type=protein; loc=3L:complement(4510524..4511018); ID=FBpp0265672; name=Dyak\GE20662-PA; parent=FBgn0237967,FBtr0267180; dbxref=FlyBase:FBpp0265672,FlyBase_Annotation_IDs:GE20662-PA,GB_protein:EDW93322,REFSEQ:XP_002093610,FlyMine:FBpp0265672; MD5=9c8a7db129533e925f7a0d4875c71301; length=164; release=r1.3; species=Dyak;
Sequence
MSHLHKIEDLLNQLQKQEKDLQQLTAEESRTATPEQRLDQLQSCTSRMHLYHSRREELLS
SLEEAISQYESTTPLVERIAQMIGQVNAVNEALDYMYEIRVCSICELNCEPDGRHSLVSL
PCGHLFGLKCIHKVLRESNRCPSCSRRARHRHVRRIYGLSFYPF
Download sequence
Identical sequences B4PH85
FBpp0265672 7245.FBpp0265672 XP_002093610.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]