SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265925 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265925
Domain Number 1 Region: 207-362
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-36
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 1692-1837
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-36
Family Spectrin repeat 0.0000217
Further Details:      
 
Domain Number 3 Region: 630-781
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 4 Region: 104-254
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-33
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 5 Region: 1798-1952
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-33
Family Spectrin repeat 0.0000396
Further Details:      
 
Domain Number 6 Region: 744-878
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-31
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 7 Region: 524-678
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-31
Family Spectrin repeat 0.0000975
Further Details:      
 
Domain Number 8 Region: 312-466
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-30
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 9 Region: 1377-1527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-29
Family Spectrin repeat 0.00000108
Further Details:      
 
Domain Number 10 Region: 1149-1283
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-28
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 11 Region: 846-966
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 12 Region: 15-150
Classification Level Classification E-value
Superfamily Spectrin repeat 1.21e-27
Family Spectrin repeat 0.0000239
Further Details:      
 
Domain Number 13 Region: 1039-1177
Classification Level Classification E-value
Superfamily Spectrin repeat 1.61e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 14 Region: 2065-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-24
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 15 Region: 1915-2059
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 16 Region: 1533-1637
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 17 Region: 2290-2409
Classification Level Classification E-value
Superfamily EF-hand 8.09e-22
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 18 Region: 966-1040
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-20
Family SH3-domain 0.0000604
Further Details:      
 
Domain Number 19 Region: 2181-2290
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-17
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 20 Region: 1288-1336
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000792
Family Spectrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265925   Gene: FBgn0238203   Transcript: FBtr0267433
Sequence length 2447
Comment type=protein; loc=3L:complement(1731588..1731716,1731777..1732377,1733494..1734097,1734158..1736081,1736829..1736924,1737223..1741212); ID=FBpp0265925; name=Dyak\GE20915-PA; parent=FBgn0238203,FBtr0267433; dbxref=FlyBase:FBpp0265925,FlyBase_Annotation_IDs:GE20915-PA,GB_protein:EDW92906,REFSEQ:XP_002093194,FlyMine:FBpp0265925; MD5=2972c25015877cec6ec880e4debe3edc; length=2447; release=r1.3; species=Dyak;
Sequence
MENFTPKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELE
SWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFAS
ESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEF
GQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAW
QRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKH
EGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKL
DESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSF
KLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTE
QADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQ
HYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFAT
DDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIV
VLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQ
KKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERK
QHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHE
ARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFA
DANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCR
QQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVP
AAYIKKIEAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVR
EAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQL
TSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEK
ANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYA
KQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVT
GAEALIERHQARRAEIGFTLGSSSAPGAAASTSSIASPSGDEEHRTEIDARAGTFGAFEQ
FGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESW
MSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASN
LVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYK
DPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQW
EYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKH
QLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARL
NEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELASHEPAI
QAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVE
EEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAK
NHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVR
SDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGD
VIARWQKLRDASDTRKQRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRC
NSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWR
NLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRTSMMEGSGSLEQQLE
ALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQH
NLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQ
PDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTK
EELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN
Download sequence
Identical sequences B4PDU1
XP_002093194.1.41174 FBpp0265925 7245.FBpp0265925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]