SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265997 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265997
Domain Number 1 Region: 1283-1460
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-50
Family DBL homology domain (DH-domain) 0.000000296
Further Details:      
 
Domain Number 2 Region: 1467-1583
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-29
Family Pleckstrin-homology domain (PH domain) 0.0000271
Further Details:      
 
Domain Number 3 Region: 856-998
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 1088-1226
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 301-418
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-17
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 522-666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000236
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 7 Region: 782-896
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000101
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0265997
Domain Number - Region: 15-111
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00392
Family CRAL/TRIO domain 0.021
Further Details:      
 
Domain Number - Region: 671-774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0176
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number - Region: 152-227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0262
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1001-1122
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0592
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265997   Gene: FBgn0238270   Transcript: FBtr0267505
Sequence length 1639
Comment type=protein; loc=3L:complement(996971..996976,1000653..1000856,1000915..1002795,1002855..1004960,1005529..1006072,1010252..1010430); ID=FBpp0265997; name=Dyak\GE20987-PA; parent=FBgn0238270,FBtr0267505; dbxref=FlyBase:FBpp0265997,FlyBase_Annotation_IDs:GE20987-PA,GB_protein:EDW92777,REFSEQ:XP_002093065,FlyMine:FBpp0265997; MD5=e5ceb7fddd73194b8af7945318dc0daa; length=1639; release=r1.3; species=Dyak;
Sequence
MDGQRARDLLTLLQERVVFLTGGRDRRGGPLLCFPATPRRDRLKPEDLRRLLSYLISIPS
DAAKNLGFTVIIDMRGNGNCSTNVKTILKVLQEHFSANIHNVVIIKPDNFWQKQRASISS
HKYKFETTTVSIESLNKIAESHQLTGDFEGQQLYDHQQWTDARLAIEDFFWQAGDMADRI
DDLQEDLNRNDFAEDVPLARHAIDHHNEMRKKITKLPIEDLDMQGKKLLAKINAMAPPGG
QAPSNSGGSDMDSGPSSAGQQSQPSQQSRSVGGNPDMSAAVNKALRQIELIHTGQEKLLM
LWQHKKVKLDQCFQWRLFEQDCEKMFDWILHNRDVFQMSYVEIGHNYSVAKSLQDEHQKF
AVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWKDFAAGLDERTAVLQLS
VLFHHKAEQYCNSVASWAAACQASQPLPSDIQSLETAIRTHQSLYEAMCQAYTEVHSTSK
KLLYQLDHLVQVCNQPPPPGVPDHRKNSNGGSFNKYERQNPAADYSEGASHVLAVIHQIL
SHHRTLEAKWHQERLRLHQTLALRLFQEDVKQVLDWLKNHGEVFLRKNTGIGRNFHKARV
YQTSHDNFENVAQNTYSNAQKLLAAADELARSGEADPNEIYSVARELELQVGSFAERVEQ
RRRRLDMAVIFYTHEKDVTAWIDKLRTDVSTDETRLSQENLEGIERILQQYQRDQQESSV
NVCLTTISQGEALLQEMRSLEYADNTGSIAALEATLEKLNKQKVELEELWSARKFRADLI
LRLRYFERDARLLSVQMEMWSEELQHADLSRDYQKAEQLIRMHNESVTEIQNATYEVVQQ
GQDLLQLFENAGFISMADATHTAQARIEYLLDFLREREIDLEEMSEAKRAKLEQAVQLCQ
FQNDANQVISWIRNGEAMLVASFVTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRA
DALINANHYDPLSIDEISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLE
REYKREDDWCDGGGGSDKAQAIVQLISKHQEQKEAFLKACTLARRTAETFLKYANRSQQC
YQYKGNCEGHVKSKLDKLLTQENQVLDFWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTG
EAYLSSRSNLVGISKEETEGLLKEHNEFRSTAKETRERVKLLIQLADSLVEKGHAHASDI
KQWVASVDQRYKDFSNRMDSYCEQLEKSLGMSQQQLLLGSDGNSSISSSSGDRHSDPTLE
AKLNSSNKENKEINEEKRKSARRKEFIMAELMQTERAYVNDLATCIKCFLEEFRVGKNVP
SALIGQEDVIFGNIREIHHFHQKIFLRELEKYETMPEDVGHCFVTWASKFDMYVHYCKNK
PTSNNLLVQHGGSFFEELQRRLEVDHPLPAYLIKPVQRITKYQLLLKDLLSCCEESHGEI
KEGLEVMLNVPKKANDAMHLSLLENCDVSVDKLGEVVLQDAFQAWDTKQIIRKGRERRVF
LFELYLLFAKEVKESNVVKYQFKSKLMTTDMGITEHIEGDETKFAVWTGRSPMLSDCRIV
LKATSLETKQIWVKKLREVMQETCFSGTSLTLPKSPAKHSGSSQRSSRDLDEQLTENDHD
RCSLASFGSGNTTDSDNKP
Download sequence
Identical sequences 7245.FBpp0265997 FBpp0265997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]