SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0266028 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0266028
Domain Number - Region: 252-353
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000137
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0266028   Gene: FBgn0238300   Transcript: FBtr0267536
Sequence length 2275
Comment type=protein; loc=3L:complement(411217..412267,412330..412721,412786..412961,419408..419513,419592..420046,420109..420341,420431..420572,420843..421809,421953..422132,426269..426442,427450..428097,429178..429849,430484..430771,438786..439172,484619..484780,484857..485108,486790..487332); ID=FBpp0266028; name=Dyak\GE21018-PA; parent=FBgn0238300,FBtr0267536; dbxref=FlyBase:FBpp0266028,FlyBase_Annotation_IDs:GE21018-PA,GB_protein:EDW92722,REFSEQ:XP_002093010,FlyMine:FBpp0266028; MD5=938639090a2423d7a621d0d974736a1d; length=2275; release=r1.3; species=Dyak;
Sequence
MEVQQKSETGRGEGVIPKPEKEVALISNQETEKAAMINGGTEGSARDSESPSETTATTRN
KEHTTKPLKLDGIFAMPATPPNKGGLTTKSASSSRSSSLKKQRRGSRGGATLNAAGNGDG
APKSSAPGGGQLNYGSNSAGNDLMKQSQSMTSLQASNEEQQESRDVIQAKLHLERPYNSL
KKNSHSNKMHRYSWGSGNSQCSSTSLHSSATLGLGSSGKDDLWAAIQTNYNYIMDTNLLD
TCKEARCEIEGAATVLEKSSECCFKMLDETQRPEGLCEDPKELRRWLREMESKLESSPTI
TELTLFGNSELQRHLAVHSVLYHEIASHARVVSSCIQAAKKEQQLQQQQQQQLSSQQPAS
LTSNCSSESTSESATKSSSLSSGFASDPVATPIGTTAAAAPPPSSTQPSKKGEGNLERLR
DRYHLLYLKAFELQLCLDNLLRKRSSTANGLDDDEDDEEEDTEDDSFGYEGEATEDDLNE
VNSDLDLENSESKSATPAELILQRCQIAATQIVCGLDETRSQPVTSQAKSPSADQPRDCL
APQKPGDEADEELEEEDEDPDLGTDVVDFLIAKRSWRQANHPNPSATATLTDFEADSESS
DFEQVQQLSRRGLPLAVGSTRRVLNLIEMPQSSNGNINSSNSLLQQRNHNIGNKMLPNKA
HGKNIAVAVITPNSHGNTSHGHGLGHGHGHGLGHELNKSPLGLRKTRHHHNDTSKFNRSN
RKSKNCAIFYFKHLDTDNEQGNAAGSDLQSEDDPSLIHRRRAAAAGGDILKSADASTDDD
DEGWLYTATAAATLEVATPATAAPTAPAAATSIVDGLQSTTISSTTATGGALPPSDDSDK
ENKVALVSATTITAAATTTATATSIATLHGSSYDSSSACSSSNSHSNSNSNSNGRLTETS
ATSRVTQLQMQIHSQSQMELQINGNAIEGRHIISNNNCYSSMQHQPQNNNEGEAAEDLAK
IRMDMDVDEAAADMANGNASKSQQMSSSLYSRADTCNFSVWAAETVASCHLPPRSPAKSA
KSSKSQASNATMSASTLVSPVKGKVSHDSIKQLVLEAEHLVRDAQETALKTPTKQKHSII
KISSTVKKREVTMPHPIKQRVEEWLEHQPSTPQLLTRSHTHELLPSCKPDDCEASGEASE
TDSVPQAGAGVAGGAPNGAGSDTSEGFTDSIATCMQTSTNSYGNSTERIGGSAEPIGQPV
TPLGFGSSNQSLNVKIVKRTQTRRKSERPWSVSCLSQLTTDAAQLTTARIVENSPPGLAS
HSISESALDSLSPGPRPRAASSSGTGSNAAKKADSKGSLRRRKARKKRISAASAGRKSDS
GSELGGDLTQTLMKSCESMSSQQLQEFTNALLSIQKGAAVAPLSPKGEASGVPSLAEGET
GETQLMLPKFRVGSFTTAGLLATDTRLGALAALSNYMNEDEQQAELSTEDHHSSISETAW
DNYQEKYNSENYSEGFDSDAARRLLEFGDDYRNFIDSQSDCCSSLSAANNLDSFSPPRMD
SLQKHELKTLHINQDTITSSVDHARRQRALELQYERRRKTLEVRRKSCQDMDESLVASPQ
SEQQQQPLQVTPSLSASATALMTTPRNQSISQQISQRAESVGRKLDFGGMSHSAQSLLRR
TSESDTSTRRRRTVTADERRRSSRNLEKCIKLIPATTSSSSGSDSEDGEQEMRSLLQQSR
DRLDDTRALKIRCHLLRPEDYNEIINTCRDNIRCLEAVLRGPPGTVLSNHCAGQTKDLLA
AWEDLLGWSENASAARKLQQEMSVLKSSLQRLGDKPTPELLDTEPAIQIAVEALKLEQTQ
LASYRTNMLRLNASVHSWLTRQERRLQSALEEQEQQQESEQLKQQKPLEEETAADVHKEL
AANGAVAITVTDSNGNQVEALATGEASTSTPAWDVHSLMSAEQEFHKHLKNEVSDMYSAW
DEADARINTQLEMLTNSLIAWRQLESGLSEFQLALGQDRGTLKGLEGALDKGQATPVELA
QNVKLVAKLLSEKVHVSQEQLLAVQQHLDPNHIYHITKFTASNGSLSDSGISDGGATSDG
GLSERERRLGVLRRLAKQLELALAPGSEAMRSIAARMESAEAELKHLQNTCRDLIVRTAA
SHQQKQQNQQHQGQQISPMANGQLKKQAAKGKGEPQSPGRRGKAARKARQAKKAGEDQQG
EESGSGLSPEQQKMVLKQIKTLTSGGDGGDDPSDDPSLLFNLESSEEDGEEADPAQASKR
GWAWRIARAAVPMQVALFTIFCAACLMQPNCCDNLNNLSMSFTPQLRYIRGPPPI
Download sequence
Identical sequences B4PC67
XP_002093010.1.41174 7245.FBpp0266028 FBpp0266028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]