SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0268757 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0268757
Domain Number 1 Region: 512-591,1280-1361
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 7.59e-53
Family Transcriptional factor tubby, C-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 6-291
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-24
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 292-332
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000732
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0268757   Gene: FBgn0240904   Transcript: FBtr0270265
Sequence length 1362
Comment type=protein; loc=3R:complement(23027229..23027345,23027409..23027600,23027658..23027993,23028048..23029961,23030027..23030298,23030358..23030586,23030639..23031156,23031218..23031677,23031747..23031797); ID=FBpp0268757; name=Dyak\GE23747-PA; parent=FBgn0240904,FBtr0270265; dbxref=FlyBase:FBpp0268757,FlyBase_Annotation_IDs:GE23747-PA,GB_protein:EDW98486,REFSEQ:XP_002098774,FlyMine:FBpp0268757; MD5=84076c8b84c3a65927b01aad8d8dc755; length=1362; release=r1.3; species=Dyak;
Sequence
MDYPLRTNYNLRGHRSDVILVKWNEPYQKLASCDSSGIIFVWIKYEGRWSIELINDRNTP
VTHFSWSHDGRMALICYQDGFVLVGSVAGQRYWSSMLNLESTITCGIWTPDDQQVYFGTT
QGQVIVMDVHGAMVSQVQLSNDVPITSMAWSCEKFKMEEGEEAEPGVTNAAKRSFVLAVS
FQNGYIYLLKSFDDVSPAHINTCLNGALGMVMEWSNSRELLAVAGTLRTGVDGAKTEDMG
TPSSYTNLVKFYTETGTCLYQAHIPCSTATVSAITWGHNDKRLFIATGTQVHIAWVSRRV
ASLQLLCRLEIQASVGSESLLPLLPLPSRIKSLIGNLFAQTIRCCVPDLKSLRDFVSRPP
LCSTRLHCTMIRHDDDSNLSSGTCYTLYLEYLGGLVPLLKGKRTSKIRPEFVIFDPQVND
SPLYFQYSAEAKSSSGSSQSTTTGNSGRTDSSDSDFEERSRFGSPRTPRKKRVRPKRRNQ
AGDRLSASGGGVTNDPDSLDELAYVDTLPEEVKLVEVTSNIWGTKFKIHGLAKTVPANLG
QVTYKTSLLHLQPRQMTLVITELRDDFPPGPDPSFNPNIFSEDEDEHHQLQGIHHDAVPQ
VNVITTQDGASLKPPIIPQRRLTDGASAPLIAPMSPRPNRILARHKNSLTVNGERGAGSS
AGLSPLARAESYDDDSSNESQEAGAAASQSTTVLLHQAPSNGSGPGPSCSKTITRPKTIS
SFKNSYSRSSSNSSCQSRHAISPLYCDGAVPTLQSPKNAVAPSDIIFERPAVPAAGQTTL
MSYSSNADYANNVVQVKNALMSEPVRSANSHVNPVPLNLNLNLERMDARVKCAAPTTSST
AKRREMLYIDEETQSPTPTPSSSSMKRTPTVVSIAPALPDSITRSCSVGYLDSVAITPSD
EALSALRKDAPNKRLILVDKRRNRRKRQQQEDARRHKLQQTGKSKSLDSCDLLSLQTKLS
SKEHEQVVRKLQEISDSSACSSAANTLCFKCRNNMSPSSACKRCQPSAISVLDEITSAVP
AVEPTKESPVVQAKPAPKKRFDVITSFTDSPLFTRKHRFGIGRSKETSGTENSTPLLGRK
QDNGFSFVKQLSEVRWRRKEQPAQAQLNGSSNASTLERQPQPEITGAACGTVEATPVEAK
ASVSLHTQALTTLENIISRLRDLDEGRLTPPSTPQRLPRSSPASPAASKKNKRQQSNSPI
RHILNSPLLNRRQRKKQSIIESSDDEGNQTNGSGEESNNTGNGKQYRDLETFQKAQLRQK
LKRGKIEPNGSASCANPAPVRREFVMHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEF
RGKQVMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRLK
Download sequence
Identical sequences 7245.FBpp0268757 FBpp0268757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]