SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0269744 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0269744
Domain Number 1 Region: 11-84
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.01e-21
Family SNARE fusion complex 0.0000642
Further Details:      
 
Domain Number 2 Region: 137-210
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.1e-19
Family SNARE fusion complex 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0269744   Gene: FBgn0241838   Transcript: FBtr0271252
Sequence length 212
Comment type=protein; loc=3R:complement(9634913..9635551); ID=FBpp0269744; name=Dyak\GE24734-PA; parent=FBgn0241838,FBtr0271252; dbxref=FlyBase:FBpp0269744,FlyBase_Annotation_IDs:GE24734-PA,GB_protein:EDW96720,REFSEQ:XP_002097008,FlyMine:FBpp0269744; MD5=55f50543f5c9f193396034c96d7c085d; length=212; release=r1.3; species=Dyak;
Sequence
MAAVENAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLD
RIEEGMDRINADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQP
QRVIDERERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELEN
QNKQVDRINAKGDANNIRMDGVNKRANNLLKS
Download sequence
Identical sequences B4PVE7 Q9VH76
FBpp0081641 FBpp0269744 7227.FBpp0081641 7245.FBpp0269744 FBpp0081641 FBpp0081641 NP_524298.1.81976 XP_002097008.1.41174 XP_016035400.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]