SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0270428 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0270428
Domain Number 1 Region: 14-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000276
Family Ubiquitin-related 0.0044
Further Details:      
 
Domain Number 2 Region: 236-281
Classification Level Classification E-value
Superfamily UBA-like 0.00000000346
Family UBA domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0270428   Gene: FBgn0242488   Transcript: FBtr0271936
Sequence length 286
Comment type=protein; loc=3R:join(612708..613376,613554..613745); ID=FBpp0270428; name=Dyak\GE25418-PA; parent=FBgn0242488,FBtr0271936; dbxref=FlyBase:FBpp0270428,FlyBase_Annotation_IDs:GE25418-PA,GB_protein:EDW95659,REFSEQ:XP_002095947,FlyMine:FBpp0270428; MD5=2ceb00de66c5e90dbd5b907372e0d06d; length=286; release=r1.3; species=Dyak;
Sequence
MSTEESIEICAKGSGRVETVTVRQNELIRNLRVLVAVRFEQAIPRIILVFAGQVLSDEGT
IDGRGIVSGVTVHVVCRSEVASSAPTTPNAFSKLSRPSERLMRSWQAAHIAYLQQEPAAL
RNLLQADPRIRRLLDENAAMRHYFNSDQNLREMLSLAFSPAKQELGRRRDLHISRMEFVP
GGYKILSRLNYCMLQAYEDNVAMSFQQASHGAKTSSNPQRGRETKCEDRRSGDEGTCQHC
HQTQMEQLAQMGYKNRNRNKRALLISLGNVASAVRLLDHWNRFLEE
Download sequence
Identical sequences FBpp0270428 7245.FBpp0270428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]