SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0270557 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0270557
Domain Number - Region: 149-192
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0122
Family SNARE fusion complex 0.011
Further Details:      
 
Domain Number - Region: 57-115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0683
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0270557   Gene: FBgn0242612   Transcript: FBtr0272065
Sequence length 232
Comment type=protein; loc=3R:join(3135350..3135371,3135437..3135621,3136129..3136517,3136569..3136671); ID=FBpp0270557; name=Dyak\GE25547-PA; parent=FBgn0242612,FBtr0272065; dbxref=FlyBase:FBpp0270557,FlyBase_Annotation_IDs:GE25547-PA,GB_protein:EDW95928,REFSEQ:XP_002096216,FlyMine:FBpp0270557; MD5=365ffdb8c57a6b635d4d78609a193dfe; length=232; release=r1.3; species=Dyak;
Sequence
MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPLLGEHVFDSLS
EEIEQMLEKLSSLNESMSDLPSSGAAALHTLQRHREILQGYRQEFNKICANHTMRIEREE
LLRGSGLATSSGSPSISGLNRREMYLKESGHLNSASHLVNDQINIAIETRDHLHAQRQAF
KRLQTRFNDISNRFPLISSLIQRINIKKRRDSLILGAVIGFCVILLLLYAFN
Download sequence
Identical sequences B4PLZ6
FBpp0270557 XP_002096216.1.41174 7245.FBpp0270557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]