SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271423 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271423
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-28
Family Second domain of FERM 0.00093
Further Details:      
 
Domain Number 2 Region: 43-139
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-17
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily WW domain 0.000000000341
Family WW domain 0.0024
Further Details:      
 
Domain Number 4 Region: 199-247
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000093
Family Ras-binding domain, RBD 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271423   Gene: FBgn0243438   Transcript: FBtr0272931
Sequence length 1374
Comment type=protein; loc=3R:join(15493109..15493221,15493287..15493722,15493896..15494144,15494230..15494489,15494562..15494706,15494771..15494920,15494984..15495161,15495219..15497812); ID=FBpp0271423; name=Dyak\GE26413-PA; parent=FBgn0243438,FBtr0272931; dbxref=FlyBase:FBpp0271423,FlyBase_Annotation_IDs:GE26413-PA,GB_protein:EDW97515,REFSEQ:XP_002097803,FlyMine:FBpp0271423; MD5=cdfabd3f873a101219ed452d417f1ab7; length=1374; release=r1.3; species=Dyak;
Sequence
MTQSAGWLPACEDWSKHEELSYGWERAIDSKGRSYYINHLNKTTTYEAPECIRWDEHPPE
PRQVQLQRNASLGFGFVAGSERPVIVRFVTEGGPSIGKLQPGDQILAVNGEDVKDAPRDH
VIQLVRACEAQVNLLVCQPMAHCVLPGRKSTLLSAGKRAKLRSRPSRVRFAESVCVNGAP
LFPPSAFSLGDICVPPMANVLKVFLENGQTKSFKYDATTTVQDVVSSLLDKLCLCCGELF
SLVLEHVKSLKRNKLTLLDPQESLARIAARPGAHKLRCLFRITFVPISAAELAQRDLHAL
DYLYLQCCNDVNQERFAPELQPELALRLAALHMHQHALANNFAPAKLTVKLVEREFGLER
FVPVSLFEGMKRKELRRLISHFLKLNAEMTGSSSKVLTQLQAKLHYLDIIASLPSYGAKC
FSTNQREGVERVLLVSPRFGLSQISSARNSVPQPISAIEDFTHVVVNREDDVTCSVSIFM
LGDRAVKFIMEDRDGCEFSLVLGGYYRLLTGNVLNILREREPNDEDNAPGFLSQHTVLPA
GWSYLLPFHTRAHSVNFLMAPPYHPLVQRGQLQQQSSIQAPTSLPYVMDLDLHSVMATEL
LEEAAKDSGLSDSSGSNYCEGRSHLGSHQLEAKNEQVLRRVQELQHLVQTSEQYLSEQEQ
GGGGGGVAMLEFDSDCDSLNSSKVSSTEGSQGGTILGPGGGIPPGHPLKHSDSLTLLAET
INHELSGITQGLNAIPESAPVSTSAPPTPATPKRKPSLCSTSSPRPQRKLNGFSQLLSDL
QALGTDFSQSESDSESVASPAQSPTTRRPQMMLLQAAGSSSGSGSSGLAPAKQQLSQRSS
FGLHSPDGTHFGAETKDYNLREYLQQLKEISNAASADTDVAARQLSEIYGFEVREDTFIE
TDTDLIDLRAIPPPQTPDELDSLSLMNAAPPKGFEGKAEELDSFLQQIMVAPPTQKATPA
KELTPEEIMSFIIPPPPNLEQQQVVPAVETECLYSNSVQAKREFFQSVANGNNGSIGNNG
MSGGHSPHVIEYATVERKSKFSCCPTSKKDEQPGQEELQPPPRTPTTEQLSPPPARPPKS
AELLQRYSPKKQVRIAASPVMQPQERRELCPPQLPPRGSPTLDGSQSSPTNPVSGPKKPP
LPPIACRPRPSNGVNSPNTSSPGSAPPAHYSPPIPATVRLPHLNQANGTLPLLPKKPQQL
HGEKLFIKNGHLIDGEALLAKTDVAMAGLLIKLDQVAAQCSVAQAAGGGTSIDEEKFQRA
RNELTEQTLALVTASKFLVASMSDMTLITLPEHLTSCLTAIRRITELAQDMTRHTSAPLQ
TRNIVLKVHDVASSFRELVGVEIGPIGAGQLALQAECLANVLATLLRSLRVFSP
Download sequence
Identical sequences FBpp0271423 7245.FBpp0271423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]