SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0256365 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256365
Domain Number 1 Region: 3697-3832
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000259
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 3077-3202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000114
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 3620-3730
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000245
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 4 Region: 2358-2492
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000677
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 2790-2905
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000882
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 6 Region: 3215-3323
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 7 Region: 1915-2041
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 8 Region: 2859-3015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000331
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 9 Region: 80-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000202
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 10 Region: 2446-2583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000025
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0256365
Domain Number - Region: 2548-2701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256365   Gene: FBgn0229168   Transcript: FBtr0257873
Sequence length 3968
Comment type=protein; loc=2L:complement(10322257..10322500,10322710..10322777,10323019..10323160,10323881..10324507,10325364..10328326,10329555..10329812,10331451..10331756,10332326..10339417,10339480..10339644,10340053..10340094); ID=FBpp0256365; name=Dyak\GE11355-PA; parent=FBgn0229168,FBtr0257873; dbxref=FlyBase:FBpp0256365,FlyBase_Annotation_IDs:GE11355-PA,GB_protein:EDW88376,REFSEQ:XP_002088664,FlyMine:FBpp0256365; MD5=a20f539e0975a2147e1137e9080cb331; length=3968; release=r1.3; species=Dyak;
Sequence
MNQSSLDGMLHGLKLIQSNLEVHERDAIELKNQAKTLPTDPATERLLNDTVDRIDLLLRR
TQQGITMIANAMHGQKKRQQEIDEYQQHLLELEQWIIEVSAELASFEPTSDSSTDEQVLK
SQVERSQQLLRTLKDRQQSMEDLVEQTRQLQSHPDVAPLADTLMEQLQSIITILREQVTV
ATKRIFTIEKRIVDLRKAKSEEAQRQRVLADSLIKPPTEVPAGPEAHESIESNENTIDSS
SMPEEEIKPTGVYVETQTSLSLQQPPVQVVTTTTVEAQTSFKEPAVETAEVALQTQKERS
PTENIMVTQTVQHGQETIQIDTTRNKDVPDEPEDVQIEARYHQRPKGDVDRATELILKNV
PQAFETTFVEPDETTTEVIVGPDGTKHIVLKKVTRTRQQVVQQQQISSIETISDSDGNIE
VHSTGQINLENVHTTDTKADPEEGSVHTVITQQTRGAVVDSSQPEGVILQEFETEPTIET
YEEVIAPGSQAQLISMQPGDVQTQGTIRAVVQQVTRKVIRKTRKIIKRVVIIDGKEHITE
EVVEEPEEVEITEEETAPHINVNIVRTVDGKVVSEEEFQRMMQEPGVLIEEVATDLQKQT
TAEPQQEVFDIESTQVTTTTRTTTATTQEQEQPEQQTQPTTETTKEAPVELPAPQVDVEQ
PVVVATTSPVHVPTADVVEPNDASPTVEVEAVVEDINEIWPLEHHLKPTNIDFSQHIEEL
AAPATTVETEASMPVEEIWPTSPETGNSLTLEHYEFEPQSPHEESTKSDLVKPQETEPQA
VAETKPEAITTGSITITKTTTTITSSTEIPEETLAHNLPADEQQPPASKIKTDINSFLVA
EQTLAAALQEQSSTPTEASVVEDVKEIVQPKEIVLEERTVEISTIKTEENQETPVTVEEV
KSLPAEPEPEDSELKEVAIDIVEQTDQKPEELVVGTQPTPGQIDLRAATQLFISGEAAAS
AAPQKTFQITAPSLEDNGAGVLKVVLGKEEDTASPTTGKVSMTIIETAAAPVADAKRRRK
KKKRRDTKHEEELEQEQETEPEAVAVQEPEVSSDVPVSPEDSPRDTVRHESIVEISPDSD
LSSIETDTKVKIVEDAVVSSPSESPRAPMVELVIPTEVVELALVEDEEQQTTPRVPSPTE
KSEVEQDIKSVQTSPQHQPTLDETAVQTSLEVQPDNQENESQTLIVEITETEAQTTPRNE
EQPVAVEISTTEIQTDVSGQPAETVEISSQTTVTTTIEKELQTTPKDSPRAPEAGSSDVV
ESLVQDLVKDMTTDLPVRTSEQSTVTETTTTTETHVQTATPEPREPTEDIRPETVHEETS
TLELVQVADGEMQTTPRGDEQPVSLDDTSLTATSISVSEPYELEVKTTVAIPADSDTSVA
EPTVYEYTQTMQLPKQDKKSKKDKKKKQKNVPEVEQQLPEEPQISVTVEIAPELLTESGI
VVSTNQQIEDVPHVTPVVETAIESEEVETPKAQRVQLQITKTTVYDEYPDLPVHITEQNK
VLIASQQSKRSGAGPTSSAVTIEEVGSPTEELVVPITPGPDNLSGEPQNIWFSATTSVDK
TPIELSQALIMSESLQHYPGQQQLTNQQPILISTKEAIGDRIKQLKQATPQQATPLSNVL
HLATLSEQIKELPTEQRILEVNEGLQDLDVAIKNGDKTVIQTTVITVIEKVSTWLETIEY
RVYLIRQNSNEGPSEEKLDNYNQLNDELSTIKQNVGQLERQLSKAEPEPELLQCVDSLKE
HVDAVEQVTQQNQVQDSNDLDKWHSFEVLLYSVSAVLAELQQSYDLLINQEYPLSAKLAQ
LDELEQQHEAAQQQLAQLCQNARAFQRDFPGKKMPQDVHNAFETSKNIANNIQAERERVL
QLQSLAEEYEQTLKEFTKITVLADKLVESPIVSSSLEQLNNEVQKQRKFFVNLSHCRAML
ESLEENIDSETREKHSELHKELYNRATSLLDKASERSSKLVQAASRWTVLEKGMRDELQW
LQVAQQRVPDLSAVTSADYDQYTTLYQSLSNDISHHYVKMTQLSGIANKLQHLVQAPNLV
EETNEALIVLLKLREEVALYLHRLLVFKEIWVQYEQQTDKLEAFVREAEQELRNIQIPSQ
PTHQPIEHMRQFWEIKARFELHNNVRTDTGLSFEKSLQVIPLADEMLQRQFHAQLEDRWQ
AVAQAIELIQHNIVECLSSEDVPADEKLKMVERELQEIYLTMTSMKGVIKNEEELCLYIE
RVQVLRTRVGFIGNELGRIGLQEPAIEPEKVGELFALSHKISTQIAEELEGASVLRDQLQ
AIQEGISNQRKHQAKISVILDECEAAERQGADVLEKAVADCQAAGEELVISWQEIMRIRQ
MLHTLPMRLKMSVSPVKLERDISQLQDDHAFLESKCTNIMAILRSRLAVWLRYERQLELV
HGSVQETDFMMELIRVHGQVDYERLRKATERLEGLAGDLQNREQLIDELKGAAKPLIESC
DVQIVEQIESAVQEAVVAWHDTSENLQQLRTRYQRAVELWDKYRNASAAVKNSIDQQMDT
VKSLEQPLDALQHAKVCQDNLTTQNDRILELRDIVAKIAADVGLDASALMQGELDALGQR
LAECKDAITTLANVAETQDKERKELDKEVTLAKAYFNNVQQDISREVPQNPKESEEQLAA
LRAHLQTLARTEEQLRQLKERHQNSSEVAPSATGSDDDGILEVLALWQKIFQDTFQEYHR
LSTRLARSQNSSEALRLWRQYLQHVQSFLSCSIPEDYSSLREQQQLCAIHQNLLISQQSV
LSETPLESELSEQYKALTNLHNETLSRIMQRNGELERRVSGWNAYRQQLAALLDWLRQRE
AERHALQLRYIHLKRVPHLKHRLDAMIQQLEQGEQQSKALQEQQQELARHCDDALATAMR
MEQASIGQRISNLRAALKTWQGFLQRVTQLSESYEQRVNQLQQEFGAAQRLLDANSESLP
TQPAAIEQLLGSLRAQRVQLGAQVSALESLTVTQEELKECISPHDMKTIRQRNWLLWQQL
ADLDYQLANLINSIEERLSLLSNYQIRYDRISQWLQRLEQRVEKDADVTAMTNPEQAAKQ
LEQQVNSELQLRDKEREWLLSTSRELLTLYSEPEVRSQVQQQSDSLIDRWQRLKYLAKQK
ATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQRSI
EHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKARILT
IWNLLQQLIKLTAEHKNWLGKQESQIAGFERDQKSNSKQKLEERQKELRAKLEELESQSV
NLRQLEQIYAKLTMSAGVEPENIQKLTLPTKVMVSMWRQLTPRCHALLDAIDKDAKLMRE
FNNAQLEATNSLNAIQKALEQLPSVEDQQTSKAQPKAVLQRLESLEKKLQDAQQHVQQAD
SLAQEAKTRTKQQPQLKQLLELVSAYTTLWQTVHTRIVTLKTTWLTRAAQAAAALPVNEA
ANAAVQVNTLSQRKLRQAQQMQRETSITAKDAYIMELQTAITECQSNLDELQRTVVDKTR
KPGPQKIAKLLGNAQSSTELVKHLSHLLLTECKADDQAAEVDTVAELTLRFDTLQSQWKA
RQQHDQNASEVGRLTCPLCTQRNWQQIDNDLWRLEQWLQFAESTQKAQSAPPSNIELLED
VTQDHREFLLDLESHKSIISSLNVVGDHLATHTLDTEKARQLRSRLEADNERWNNVCINA
TKWQGLLQTALMGNSEFHQTIDELVEWLQRTEQNIKASEPVDLTEERSVLEGKFKKFKDL
RAELERCEPRVVSLQDAADQLLRSVEGSEEQSQHTYERTLSRLTDLRLRLQSLRRLSGIY
IVKLGAVLGYEGDNLGVPLHMLSSELLDNTTLSTSSMQAAAPNTENANNTDGGDAVDGDV
INTTVLARGARFLGRVARASLPIQALMLLLLGVATLVPHGEDYTCMFSNTFARSLEPMLS
YPHGPPPT
Download sequence
Identical sequences 7245.FBpp0256365 FBpp0256365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]