SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0257093 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0257093
Domain Number 1 Region: 414-742
Classification Level Classification E-value
Superfamily L domain-like 4.08e-49
Family Ngr ectodomain-like 0.035
Further Details:      
 
Domain Number 2 Region: 111-455
Classification Level Classification E-value
Superfamily L domain-like 6.12e-47
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 830-999
Classification Level Classification E-value
Superfamily L domain-like 9.23e-28
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 4 Region: 1094-1234
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-22
Family Toll/Interleukin receptor TIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0257093   Gene: FBgn0084731   Transcript: FBtr0258601
Sequence length 1438
Comment type=protein; loc=2R:complement(13487431..13491747); ID=FBpp0257093; name=Dyak\GE12083-PA; parent=FBgn0084731,FBtr0258601; dbxref=FlyBase:FBpp0257093,FlyBase_Annotation_IDs:GE12083-PA,GB_protein:EDW91449,REFSEQ:XP_002091737,FlyMine:FBpp0257093; MD5=0d1e8f91fb610c4d44d2b804f6a9af5a; length=1438; release=r1.3; species=Dyak;
Sequence
MAAILLLLLGFSWSLAVESALAPKDSESSASAMLGAGTGAAATVSLSGDYSSLLSNVPAA
SPVPANPSQHSGPANQCSWSYNGTSAVHCALRLIERQPGLDLQGADGSSQLTIQCNELYL
FESSLPVAVFARLQTLEALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLEL
FPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQLGFADMNCGA
GSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRI
VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNH
VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL
HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNE
VPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLS
VLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD
YAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFI
NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFEC
DCTMDWLQRINNLTTRQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYESHCFA
LCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNN
FPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQL
SALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLG
RNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGAGSAALEDSSSNSVSLEKREL
DFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAFRESLRIWLFA
HYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRDLAHDA
THYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALRGRPQKLVIIEEPEVAFEA
ESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNYTLELDHHNHERVKQP
ASPGLLYRQAPPPAYCGPADGVGIGAVPQAVPVNASVPAEQNYSTATTATPSPRPQRRGE
QSGSGSGGNHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPGAPGGLAMEA
AQRAQTWRPKREQLHLQQAQAGTLGSKASQSAHQQQQQQNPTAVSGQQQGPHVQAYLV
Download sequence
Identical sequences B4PAQ8
7245.FBpp0257093 XP_002091737.1.41174 FBpp0257093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]