SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0257782 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0257782
Domain Number 1 Region: 577-768,856-1012
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.67e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 460-561
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.14e-20
Family Anticodon-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 289-385
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.12e-16
Family Anticodon-binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 145-239
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000441
Family Anticodon-binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 747-866
Classification Level Classification E-value
Superfamily GAD domain-like 0.0000000024
Family GAD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0257782   Gene: FBgn0230493   Transcript: FBtr0259290
Sequence length 1141
Comment type=protein; loc=2R:complement(4269632..4270498,4270562..4272019,4272076..4272165,4272227..4272405,4272471..4272971,4273141..4273303,4273380..4273547); ID=FBpp0257782; name=Dyak\GE12772-PA; parent=FBgn0230493,FBtr0259290; dbxref=FlyBase:FBpp0257782,FlyBase_Annotation_IDs:GE12772-PA,GB_protein:EDW90219,REFSEQ:XP_002090507,FlyMine:FBpp0257782; MD5=0e1df0f45b083b344773d08f22c79af8; length=1141; release=r1.3; species=Dyak;
Sequence
MLLISRTLWRSHQRLQLQQQLAHSASSGGFLAERHIRHRSTPDSLVSAQEPADCGHIMSG
RYRGGGGGGGRFGGRGGGGYADSGGYNDFDNYRGGGGPGFGPGPGPSPFNMGGPNISGNE
LMQLMSAMASNFNMNSQLPQPMRQSCGELRNHHCGLFVELSGRLIKKRVNRFAELRDRNG
GACQLVVLEDKHPRVARRMNNMPENTTLTIVGLVMRRPHNSCNQTMPTGEIEVEVQDILN
IHFPASGTKRAGDKRTYSTMVQQQSNLGITSTEYKIAKNENILKYFENRDLTCNDLRRDD
VGKTVTLVGWIPSTKNNKFLQLKDGYGQTQLMIEDQSLSDTFLSTPEQTVIQIVGKVLGR
PKANVNLKYDTGEVEVSVTSVKVLNPDDPYDGPIKAKEKQQKLSIDDLEAEEAAAEASAN
LSSNNGESKEDAAEAATTANPSVTAEQRVKVADTNKFADRTHNCGELTSNDINEKVVICG
WLEFQRMNKFFILRDAYGQTQVLLLPKTEGLEEYADTGVPIESIVRVEGTVIPRPAATIN
PKMQTGHVEVEADKVVVLNPAKKNLPFEIRKFNRAGERLRLTHRYLDLRFNDMQHNLRLR
SAVIMKMREYLVNYLGFVEVETPTLFRRTPGGAQEFVVPTRKAGHFYSLVQSPQQFKQML
MSGGIDRYFQVARCYRDEATRPDRQPEFTQLDVELSFTSRDDIMQLIEETLRYSWPKDFP
RLQTPFRRITYEEAMEKYGNDKPDTRFGFLLNNVSEIIEKSDDFKEKYEDLGAYAIVVRA
SEAFWNGAARKHYESLGKEFKGTLFVRKFGPTKDVQEKLGKLLGEDVATEIADKFDLEEN
DLLFLGIGPKVETRAMLGRIRLDYHEFLVENDKVKKPNDFRFLWVIDFPLFERNRETNQL
ESVHHPFTLPHSDDLDNFATSCENLEIIRSQAYDLVLNGQEVGGGSIRIHDRDMQHFILE
QILKIPHDHLSHLLSALESGCPPHGGIALGLDRLIAILCRARSIRDVIAFPKSLNGRDPL
SNAPVPISDEEMRLYHLSVVEEEEASTNNTSHEQEDDDPDQERAPPSPMSATSESEQPQM
DVDIKTEPEDQKEDFDSESVSVKTPTKAAVKAVSEEPPPTEPVASVAATPTRARRTVKKK
V
Download sequence
Identical sequences FBpp0257782 7245.FBpp0257782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]