SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0258343 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0258343
Domain Number 1 Region: 219-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-30
Family Calponin-homology domain, CH-domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 7474-7632
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-30
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 6498-6657
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-27
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 4 Region: 3673-3850
Classification Level Classification E-value
Superfamily Plakin repeat 3.01e-26
Family Plakin repeat 0.0083
Further Details:      
 
Domain Number 5 Region: 4265-4405
Classification Level Classification E-value
Superfamily Plakin repeat 3.49e-26
Family Plakin repeat 0.0081
Further Details:      
 
Domain Number 6 Region: 7372-7522
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-24
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 7 Region: 338-455
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1498-1561,1629-1737
Classification Level Classification E-value
Superfamily Plakin repeat 3.92e-24
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 2304-2372,2401-2482
Classification Level Classification E-value
Superfamily Plakin repeat 3.92e-23
Family Plakin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 4753-4947
Classification Level Classification E-value
Superfamily Plakin repeat 5.49e-23
Family Plakin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 4112-4256
Classification Level Classification E-value
Superfamily Plakin repeat 8.5e-23
Family Plakin repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 1932-2082,2147-2170
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-22
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 7270-7412
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 14 Region: 8450-8525
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 15 Region: 5753-5896
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-22
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 16 Region: 7713-7852
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 17 Region: 6610-6756
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 18 Region: 6083-6217
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-21
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 7044-7191
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-21
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 20 Region: 2502-2735
Classification Level Classification E-value
Superfamily Plakin repeat 2.01e-20
Family Plakin repeat 0.0052
Further Details:      
 
Domain Number 21 Region: 1730-1885
Classification Level Classification E-value
Superfamily Plakin repeat 2.7e-20
Family Plakin repeat 0.0037
Further Details:      
 
Domain Number 22 Region: 7917-8038
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 23 Region: 3865-4036
Classification Level Classification E-value
Superfamily Plakin repeat 6.54e-20
Family Plakin repeat 0.0098
Further Details:      
 
Domain Number 24 Region: 4502-4605
Classification Level Classification E-value
Superfamily Plakin repeat 3.92e-19
Family Plakin repeat 0.0068
Further Details:      
 
Domain Number 25 Region: 745-866
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 26 Region: 7598-7707
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-17
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 27 Region: 5265-5410
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 28 Region: 6722-6865
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 29 Region: 8068-8181
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 6923-7050
Classification Level Classification E-value
Superfamily Spectrin repeat 4.55e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 31 Region: 8135-8257,8309-8340
Classification Level Classification E-value
Superfamily Spectrin repeat 7.32e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 32 Region: 656-787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000208
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 33 Region: 5465-5588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000354
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 4014-4113
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000379
Family Plakin repeat 0.0048
Further Details:      
 
Domain Number 35 Region: 6278-6436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000013
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 36 Region: 8359-8469
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000182
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 37 Region: 3560-3720
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000249
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 38 Region: 6011-6112
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000034
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 39 Region: 5866-5997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000605
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 40 Region: 5653-5787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000448
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 41 Region: 5006-5143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000592
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 42 Region: 1225-1326,1360-1384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000605
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 43 Region: 5152-5261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 44 Region: 7200-7306
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000152
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 45 Region: 4637-4725
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000589
Family Plakin repeat 0.016
Further Details:      
 
Domain Number 46 Region: 1153-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000892
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 47 Region: 594-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000051
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 48 Region: 4415-4505
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000249
Family Plakin repeat 0.0069
Further Details:      
 
Domain Number 49 Region: 994-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000916
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 50 Region: 426-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000104
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0258343
Domain Number - Region: 872-926
Classification Level Classification E-value
Superfamily SH3-domain 0.000157
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0258343   Gene: FBgn0231014   Transcript: FBtr0259851
Sequence length 8804
Comment type=protein; loc=2R:join(7159989..7160618,7160779..7161058,7161120..7162033,7162094..7162462,7162694..7163612,7163949..7164579,7164690..7164825,7165784..7165867,7166574..7166795,7171250..7171380,7171659..7182153,7183686..7183832,7183894..7191371,7191753..7191978,7192043..7194002,7194058..7194232,7194855..7194899,7195292..7195363,7195514..7195688,7195755..7195872,7195936..7196165,7196227..7196344,7197832..7198025,7199250..7199523,7199586..7199769,7200080..7200145,7200697..7200838); ID=FBpp0258343; name=Dyak\GE13333-PA; parent=FBgn0231014,FBtr0259851; dbxref=FlyBase:FBpp0258343,FlyBase_Annotation_IDs:GE13333-PA,GB_protein:EDW90563,REFSEQ:XP_002090851,FlyMine:FBpp0258343; MD5=91c8a06092654f0773fc113fea9a2297; length=8804; release=r1.3; species=Dyak;
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSSLRYRHETKRE
RTVEAVITDYPGVSPLGSVPHERTNFERTVTFQDPAGNSRRLSETRALVPAGPIPSSSTH
YQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENAQPAEDLL
PPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLL
DPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCRE
KTAYLQERSFPPTLIEMKRLLSDLQRFRSEEVSARKREKSKLIQIYKELERYFETVGEVD
VEAELRPDAIEKAWYRMNTALQDREIILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
TRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKK
VNKLHQRWAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEH
IEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELA
LYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHKYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLL
QLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQD
LREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTL
LDNSGRVKWRVRTANGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREM
DEVNRLFDEFEKRARAEEESKQASRIFTEECIAIKSKLEDMARELDQIILAPLPRDLDSL
EHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHK
DRLKLLEASLAGLEDNEHVISELENELARHQDLPSTTEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMK
NLQSSVQVEESWVDGTTQGLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREA
KIYDGKCLRFVDWLVEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKYDRLLEQLS
QRLKTAIEVNGSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQI
SSTKTTKSSTKSVYGSDGLDAASQDVSTAILPQSQIQFNEIRTLKRSQQLGGHSVLDIAG
IRDPRTGRVLTIGEAIQLRILDVRTGEMLVGDRRITLEQAADQGLIDVQLAKQLLEPGAG
RDANGRELSLLEVIQREISEAESGYETAEKRIKVNNTITVEQASGELGSPENPRNIADAI
TAGSVDTKTGLYRVKSGQTISLAEAYERGYLIRHESVTIKSNALCLSDAIAHGLVDGAGW
IADRNSGDKFRLDSAIANQLIDASVREVVDAKRDTKITLQEALQSGVLNAKTGRYVNEVT
KEKLTFAEARNRQLIVKPYTLKDICDLNLLDKQAQITSPMRREKLSIMQAIEAGVLDGNL
LKCITKRKGELVTLQEAIADGIVLPAECKYRDFMTGELISIPEAVERGLISSVAQRSIFD
IDGFKDLRSNDYVSFNVALSRDLLRRKSTGFALETGRDSLVPLEVAVSEGLVRQEVYEMF
SRGIGVQNASGTELSVFDLVYHNLIDPKTGYLLDPKTGETVPLDTAIERKFITPEGALLL
SSLLNITLTTETVTRTINRYVTIRAGSQEPVDSVLLTFTEAVRQGFIDEERQLFKDPKTG
NIYSVQQALNYGLLVPDSNQTVPEPTNRKKTKSTITIVTKQIIPEAEPIKLNTQHTKYVE
KSVEIPISQELVKPHRVVSEFINLEKSSYIEQNVTERQIMELPPGGWRLKDAIEQRLFNP
DTGVFHVQGTDRLVNFGECINKQIINKLSLSVIDPSTGDKISVQSAFERDILDSYGNYTN
SRKQVQGMRSAIDESKIILETVPATRGANQKTILRITKVNNIPDVLEVSTPLKDAPPKFV
EVLTCQRELASPEPLQIAPGAIYDPSTALVIFTQTGETENIFEAARQGLVDEQLIKIVDP
TTKQPISVTEAIARSIYDPKTATILDSEGQPVDLITATKLGLLSVVGAPLVAAEGALRTV
RFVTDPRTGEQIPVEVAYERGIVSRDQLHRGRSFDSEPTTVEDKVVVLQRMRKVILKPKD
ALRKGIIDEETCEILENTSNFTNPKGEVVNITEALNTGLIDGRRGQVIDPQNNRVLNLRQ
AVEQKIIDSEQTNHILMPLAKSLSVPRLAGQGLIDPQTQTIVHPESGYPLSIHEAIVCEV
LDPHSKLHKPEKCTLEEAITKGIINADDSTFSYKNKTLNITEAIEEKLFDPSYDQQKSKV
EIPPVGMIFPVAVEKSLVEPSKRVVLHPSTKKALPIKQAIEENFIMSIPYSPKPDAIEVV
TALERDLIDVASQTLTVPSTGERIPLRQAMENGILVVKNLSDFVITQKPIPKTEIMETVR
AVHTVTTKTIELMQGYVLISNNEVQYVSTGEVCSLEEAKELGILREESTTRETKAAAGES
PESIGAVVTSGDQTVIVEERTQTVVVSSDTRKQEMQVVSTTQSTKDTSVPIVSEIETKAS
KEPSKTLQNVKDAAKLGALGVIAAPVLAGGAIVSGVKSLIKSVKSPTEDAKTTAKPNEPQ
TSFIEPERRKELQPQQVPSEVDSLLSETENFISSTTANFIANEKQQDKPDTLPQKRDPFE
VESTSTLTTTTVTTITTSSTTTETGNQEPVVVEDVSTTVKENTVVVEPSKVPEDKTEVSK
TTETITTVITNKTDTVPENISQEQTSEESAKNEPEVPKDTSSRPAETEASPKPVQKELTP
EPAPNAEFTESVKKDLTPKPEYKENTTQLAQITSKDISPAPTSENEHSAEPTSKPEPMPR
AAKKEDISEIEPPFTAPLAPFVDQVSDTKITEIKTEIEEPVTSSQTITTITTTVKTVDEH
PTVEEVSGINKSENIVDVQAKEPAVQKPVKVNETSDDTTRPEPTSEIVLEERVVTVEKPT
ITETTVTTTTITTTTSLGSAEALPQAESTPTVKETPLNEPVPSSLVQPTEIKQITQGDDK
KPVEIVDTARKTPEQEPVKTIPAEPFSTSETTETITTKTTIVEEEKLHQPSDLEQIIQPQ
TNPEKHQSIVDFIEQEKSTQPAESGSKILQNVKDAAKLGALAIVGAPVLAGKALVDALTT
EKTVKPEHSTTQVVTETVEELPTEIISTSTATLVTKVTTTTTTTTTSTSEGTPDDEARDV
VTLPTELVDSSVKREVPRTLAIGDAISQKLISPDECQVIVDGEQQSQTVSTLLKEEQLSP
LDEVQIIDDKLIVLQQVSYLVDADTELTPQNLYELNIYDPENQYFIDPSTGQKISFHTLV
FDMNVFNPETILVKNFSTGKYETLTAALERPLLDRHTGHMVDPKTGKKIPFFECIDRQWI
IRANPEEQKPSGIENVTIDTQTGQVVLDDGRVCSIVEAINSGKLDIQSISVRDPVSGEVI
PLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGARKPISLEAAVRKGLYDPE
TGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKLDCAIEDDLVLPATGQIKD
NKNNTLVPFDVGVQQRLLKTDNVTWSLPELLQREYYTPSTGKVLNPVTGEEILLQQAIEM
GFVELETTLVKDVDHDKILPGKEAAKVGLLDTVRGTLSSPNISLDEAFVKGYLISTKKPL
SLVDCLLRGLYDPSTAKFTIDDKQLDLKTAIAQKLINPEELVLLDPKTESIISITEAIAK
GYLDPIEGYVINPYASTKLSLHEALENRILIPPKRKRSLPDAVYRGLYDPKTGQFSNTVT
REKLTTERAIRRGILDPDSTVVNVGSGQIIPFGVATETGIVDSKHGTVRDTDDHSIDFKE
AFDRGILVEAKKPLRLIEAVVKNVYDEVDGHFVDPKSGEKLNFAEALNTNLLDEHSVQIR
DFKTGLYKQLNLTHAKDNGIIDAQNSKLLYNNQTMTLKHAFDIGILMDVNAPISIQRAIH
QGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNGIINR
REGVFREPGSNSFVPLGEALSLGLIVDIENAGFGLYELLSMGFYETSTRKVLHPVTNRKL
NLNEACVEDVVSLSSSLVKHHETGKYLRLANAIKEQLIDDSSGCYNLGKEQLDLQAARAK
GFIVSNRRLLSLELVLRQQLYRPETGKFCDPTTGEYLDLIEAIHSGFIDPATTVFKNQLT
GKELPLTEAIENGDIDVTKGRVFDPKSKSAYNYDVALSRGILVTISRPLTDRNDVVRRQD
SVELLSQTPVSVVISKPREMSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGLVDT
TKRTLVDPKALFFAFDPTLIVYVREPVTFDQAAESKCLDLQTGMLTYVPASGPGSAPAAS
ASDDSANDSLTVIETPKVYTLKEAASAGVVDPDSALVKDLAKAKLVRLPEAFRKGLMDAN
KANVLNTQTSKLCTLQEAYESGLICTPKRSFGLLEAITFNLYNPTNGCLVDPFQMHPDII
RRRKFTLAEAIGSGLVDPSSTVVRDPSTGVIVPLTAAISSGLIDATEGRLTDANEPKNNI
DLVKAAEKGLLLPAEQRQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELRN
QINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDRVN
DRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVRE
FVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQE
VSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALEKANEWLRSVHPRVSRIISEPIAG
DPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLELPIADLK
NNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKLNLRPASLIKERLQ
EQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKFEKLYEK
ANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSREK
DQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQ
QLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDKIKQQHDELKPICKDYRDYAPTIDKIN
DIGAQYDALIRPESPARKRSTYSPIKRASPLRRMSGDARSPSPTKGGILSPLSTGSSGFG
SRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLA
QFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQVKDILRRKSDVP
GAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERMLTVLGPI
SSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVETKLKDILG
KWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDSLPTDGDHQENLRKI
ENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLDTKKA
ETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMAR
EHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQ
TSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLGETF
LTSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLGDFNDELRNLDHSLGRC
EDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADH
LTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPP
GREIKIVQVQIDDVGKIQNKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKT
LGRLDNRVRDHEDNLQATLKALREFYDNQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQ
EDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMN
ERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKM
LLDRQNSMGSLANLGKEVANHCEPSERASIEKQLNDLMKRFDALTDGAEQRELDLEEAME
VAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDRLHDEILGKKPDFSDL
ADVAAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLAESRQGLRHLVLSYQD
LVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHI
SNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAA
LAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDS
IVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEH
RSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLG
ILEQALPLSEHFADSHQGLTSWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEH
KPLLDKLNKTGEALGALVADDDSAKINEILDTDNARYAALRLELRERQQALESALQESSQ
FSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAA
NDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILNVAEPFWKQLNSV
MKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCG
EPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKF
AHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPL
SVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQ
LLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQL
LQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFM
EVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKI
KLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTH
REAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEARE
FNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYISKLKETHRQLGAKQSVYDGTM
RTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGEL
LDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGN
NPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYA
KNAPDDEKVSREMMDIHMEFMKDLRVREREKSETFEYAEDIINKAYPDAIPIIKNWLSII
QQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPP
VEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVFKGSRDQGLNARKG
SRITPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSSRAKLLWTKWRDVWMLSWERQRLLN
DHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGIL
NTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLVM
LCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAK
GRTNIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQGP
IIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTP
GGSRAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQRKPSTGSTASGATPRP
ARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIRRN
ISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences B4P453
7245.FBpp0258343 FBpp0258343 XP_002090851.1.41174 XP_015052460.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]