SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0260454 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0260454
Domain Number 1 Region: 1034-1147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 1726-1835
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-30
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 440-563
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 4 Region: 1373-1485
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 561-671
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-30
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 6 Region: 1489-1603
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-29
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 7 Region: 1150-1265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-28
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 8 Region: 912-1029
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-27
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 9 Region: 3556-3667
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 2207-2316
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-24
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 11 Region: 3182-3298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-22
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 12 Region: 788-905
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 2829-2947
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-18
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 14 Region: 2944-3061
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-16
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 15 Region: 1966-2070
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000314
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 16 Region: 2449-2571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000183
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 17 Region: 3063-3183
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000209
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 18 Region: 2073-2179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000523
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 19 Region: 3319-3373,3399-3442
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000236
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 20 Region: 676-788
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000196
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 21 Region: 89-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000539
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 22 Region: 2693-2828
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000497
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 23 Region: 1841-1923
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000955
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number 24 Region: 1265-1368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000432
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 25 Region: 2317-2446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000196
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 26 Region: 403-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family EGF-type module 0.013
Further Details:      
 
Domain Number 27 Region: 140-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.017
Further Details:      
 
Domain Number 28 Region: 3464-3541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000236
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 29 Region: 363-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000534
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 30 Region: 1605-1706
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000602
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 31 Region: 251-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000591
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0260454
Domain Number - Region: 217-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00322
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 318-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0744
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0260454   Gene: FBgn0233020   Transcript: FBtr0261962
Sequence length 3684
Comment type=protein; loc=X:complement(18044857..18045110,18045179..18045854,18045923..18047716,18047787..18048281,18048360..18050686,18050752..18051433,18051498..18051862,18051924..18052086,18052138..18053874,18053944..18054639,18054693..18055445,18055511..18056263,18056470..18056653,18056840..18057015); ID=FBpp0260454; name=Dyak\GE15444-PA; parent=FBgn0233020,FBtr0261962; dbxref=FlyBase:FBpp0260454,FlyBase_Annotation_IDs:GE15444-PA,GB_protein:EDX02857,REFSEQ:XP_002101749,FlyMine:FBpp0260454; MD5=f7f00f51b3f8d3ab5e59674d7e0b2108; length=3684; release=r1.3; species=Dyak;
Sequence
MELLLATNGSKKRTGGKDEWNTGDDFVGTRELAEQLADFNRRAFGANGLNAMLRLQQNRT
RGSMALIRRLQSRVRVVENQVDRIKTQLELNSCASGPCVNGGTCYNTYTGFRCQCRSAFE
GTKCELDVNECALYEGTDLGCQNGGQCQNQFGTYSCLCQPGWHGMHCTQRKADCSQSSAW
ELCGHGSCVPSADDAGYRCICEQGWKTNGLTPICGEDVDECSDSAGHKPCSTNCINLPGS
FTCAPCPAGLTGNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPIGWTGDGRK
CQRSPQDYDIQTGQTPRSCPAGNNPCYAMASCFLISGTTSCRCPMGMVGSGYGPNGCVNG
TTTNCMGNPCLNDGICLDAGPSNFTCLCPSGFRPPICEPLPSPCDQQPCKNGGRCRPTTS
GDLFVCQCLPGYRGRLCDTRFSSCNGMLSAPSGRLKYPPSGTGYEHNAQCAWVIRTNESL
VVNVTFQSFDVEDSTECRYDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWF
RSDNSTAKEGFDLTWNSIRPQCGGRINFDTHGTLASPGSPGNYPKNRDCRWQLVAPTSNR
IKLTFFSLQLEQHENCNFDYVLIKDTISGRELAKYCTTGTPAPLLLPTHLAEMHFHSDAE
GSDTGFQLHYSVEERVPGCGGVYSAKQGSISESSTANSEPGGVSCEYEILLAVGEQIAIQ
FVSLELDSLDCLEVLDITDEGKSILQEKICGSDEARLNPPAFTSQFNRLKIKFYARAGSF
QLNYRMACDYKLDSEQGIITSPGYPNLISSDRVCTYTINTATNTVISLKRIDFQLTSGET
DEDDNDGCLTTNLRINDGLNRQILGPYCGKNQPPEELVSQTNYLQFHLATDADSMGRGFK
FEYRSLPSGSDGCGGVHTRSGDHIRLPVDGDSYASEATCYWVIMAPANKAIRLHWNSFRL
ESSMDCSYDYLEIYDSLGAQLGDEKSKPMAKYCGYRVPEDLLSHSRQLVIKFVSDYSESD
GGFDLSYTFEERAQCGGHIHASSGELTSPDYPANYSAGLDCDWHLTGSIGHQLEIQLENF
DLELSPNCSADYLEVRNGGGKDSPLIGTFCGRDIPTRIPAFSHEMRLILHTDTAINGRGF
RLRWRAFAFGCGGRLRANTGAISSPRYPNPYPNLAHCEWRIYVHPGSGISIIVEDMEVEA
LSNCYYDSVKIYSGIRLPNQSADKVLCRYDDLPNPIIQLDNNEGTIVFDTDVSNTYRGFR
LSYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEISHLERHEQH
MPTATIPGGLYIVDGRNVQEIVSPQAVNISGELVTVVHNASNVNFQLDYRIDGCMEELRG
SEGSFQSPNYPKMYPNHLECYWLITVEQNSAVELTIDGLDLEESPNCTKDALTVSNHRNS
VVAHERHCGSTPKLVITSSGHRMHVRFISDDSHNGGGFMATYRTVKATCGGKLTARNGVI
ESPNYPLNYPAHSQCEWQVEVSPHHQIVFEMSDLDLESGYGCNWDYLEAYDLAEDDTEGQ
RLFKVCGDEEDSGTLLSSTSNMAVVRFVSDDSLSRKGFRLHFHESCGQMINVDESMFDYI
QMSRQAARNETCLWVFQAQEANKRIIFTPTHVKLRDDADQQYPTEGDCLDVGVKIYEGTE
PVGTPRLKFCRSHPPAMISNGQALTVSVPLQLVEEFEGHYMMMDTSCGSVYTALSGKFSS
PYYPASYPPNIECLWLLEASMGNSISLTLESMDLEKSDGCNRDYLEVREESERGPLIGVY
CGNEVPGVIHSRGTIWMKFKSDDDNVGEGFMASYNYEHHNEINGTEGTIQSPHFPSKYQG
AEPYSWRITVDKEYVVEVSLQYLSDLDQPHLRFYDGYSDIGARIQVTSANEPIISSTNVL
YFMANRGPFQLNWNRLSKEALRSNRTAEERTRQCGNQLITIDRSVIGFHSPGYPNGYEKN
LHCSWTLVPSNLAMHAVLTLSQIDLEMFSDECIADYVRIQSSNDLQNWSKLRTLCTLPTE
PSERIFHGTPYLNVEFVTDASVNKTGFNGIVRTACGSEITASNGLVNITEILKFSPRPNQ
DCVWTLKVRQGRRIKIDFPDFQLVNNAAGGTSDCRNYLLLRNGNDEDSPFLGRGKYCEDV
AHEVLNTTSNKAYIKFHFASPPRFLVSFRFEELRYTTSGRIRLSASGEMQLISSPYYPNL
PHPHSECIWIVEAPPEHRIMLHFQGAFDLLDATEATKECEREYVLVNDGSTELKTEIGRY
CGKRKPDTIYSSGNQLRIRYFTDVSEPHMGFNASVSVARCGGSFQSPEGVISSPSRELLM
IHEDGNRLQECVYTIELEVGSTIDLMGEHMQIPALVNGSCSQRNHLLLEEMDAFGLNGEE
KIVDTMMLCGDETKHLMSETNKIVFRYRFLDGIPSESQGFRFKYTSLGSRCGETIYASVG
VLQTPGYPMGVPHPMHCVWHVQVPKGRRVRLEILDFNMGTVENNRTRIGFRGRLSVANDF
LMQSIVGRYSRNPPAEVLSSDNTMGIDAFLLPIVQIHGIKLRFSAYGSSSCQRVSLGLNV
EKEVQFQRFNNSNPVYCSYTIEPMINSTVLIQVKEYNTSSVMMGNTHLCAMLSPLKFNRL
EQEERLMQRILCEYQAPVPGKPLPAIRVPFNIQMVISASARNGLSNLVLGYSMQACGGVV
DLEPGDNITLHQPSGMESLVGAIDCAWAIGPYTDASGEDEVLPQDIQLEVSVYGVNLPAP
ILAIQSPQSPCLHHYLKVYNGPDQNSPLLGQYCNQATAVPMVVERGLFLEYHTDSYSPNA
TFNVSVKYGSGCGGKLVYPYRAIDFAEQYKNNVECIWEVEATTGYHIGLTFHGRFYIEDS
PGCTKDYLLVQQRNENTGNWTDLQRICGRDPPEMINTTTQYLRLIFRSDGDTVADGFLVK
FERNCGGLLYADSDERVLSSPGYPDGYEKHLQCNWTIVPRSASMDGVLVSFVNFDLEQAP
ISICLFDNLTVTTKDKDKEPQRSVLCGVKHNHEYRGKEFINLLFRTDGSYSGKGFTFRYT
SRLCGGIITQTSIVESPVQHTDNKLPPLSNCYWNLTAPAGHKFSIKFVSIDFEANMNCAY
DGVEVFSGSTPDSRYRWGRFCGRFTEDLPLISIPQERGIIHSFSDERDPSNGFRALVRMM
PNCDETISLNGSTRYVYSKFNNAGGYQNDLDCHIIFQVNPDQQISVEFSNFHVQDTNGCG
SDYVELRDGGGTFADIIGRFCGQNQPPTLRSTRHTLYMRFVTDEKVTDTGFQVTINAVPR
LCGSSQITLSADGIKEVTINSPTRTPGGNYANGVSCFWKIKGDSQLRVQFINFDLHAPNK
NGSCVEDFLKIYNSEDAPLLEQGLGSDLVFNGQTSRQNGHGFAMEHVYCGNVKPDIYYGQ
SNELYLKFRSKGLEQHGGFQLQVALNSNGERHYDGLQGRVHLSQSSDCSIIIRAPPNHTL
SLYYTELIFGTFDCEVENLEVFDRTNRTLQRVCSFVDTGKSLFSNADELRLQMKTGSFLT
SLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYPTNVRNNSDCQWLIRVPSNNVVFLTFE
VFNLGSKTTCHTDYLQILEKSAAGRQREMRRFCGEDNPGYYKSRRSEVLVRFHKTVNYDG
VGWVIRFAGVYSDFRVPWYLLSGV
Download sequence
Identical sequences FBpp0260454 7245.FBpp0260454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]