SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0261473 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0261473
Domain Number 1 Region: 159-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-21
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 12-57
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000157
Family Voltage-gated potassium channels 0.0068
Further Details:      
 
Weak hits

Sequence:  FBpp0261473
Domain Number - Region: 96-160
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000654
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0261473   Gene: FBgn0233985   Transcript: FBtr0262981
Sequence length 490
Comment type=protein; loc=X:complement(2337192..2337905,2337972..2338699,2338981..2339011); ID=FBpp0261473; name=Dyak\GE16463-PA; parent=FBgn0233985,FBtr0262981; dbxref=FlyBase:FBpp0261473,FlyBase_Annotation_IDs:GE16463-PA,GB_protein:EDX01012,REFSEQ:XP_002099904,FlyMine:FBpp0261473; MD5=29939191a5b22c0571f0fdd71110b7d8; length=490; release=r1.3; species=Dyak;
Sequence
MYLHYLNSLNCYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQR
VKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKTKSQGQHYGHQKLHQYGLPPSVYQQQQQ
AQQAQQAQQQQQAQQAQQAGQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAIL
FHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYILVGMAVVAMCFSLIQTE
IVLWLRRFSVQDHRPSADPSLGVGLGVGLAGGALGQPQNNLGQHQTMFFGPAHTLTQYSS
LPRRSHLQAANHSGGGSAFQRNTPIRRSTGIPEHHLEYFVPRSISEFNLSGVGDLALPPP
RRYSPNMVGGGGGGGMGGMGMNMGGMGMSMGMGMGLPHGLQLGPPQTLLCSATPTVQQQQ
QQPPPPPAQLQIVTLKPRSEKMVTFEDESKQAVGGGAVGGGAGGSGTPPHCPHGVPTTPR
KSPAVGDIFM
Download sequence
Identical sequences 7245.FBpp0261473 FBpp0261473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]