SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0262190 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0262190
Domain Number 1 Region: 540-903
Classification Level Classification E-value
Superfamily Arginase/deacetylase 1.1e-112
Family Histone deacetylase, HDAC 0.000000719
Further Details:      
 
Domain Number 2 Region: 112-470
Classification Level Classification E-value
Superfamily Arginase/deacetylase 5.76e-105
Family Histone deacetylase, HDAC 0.00000191
Further Details:      
 
Domain Number 3 Region: 992-1089
Classification Level Classification E-value
Superfamily RING/U-box 2.71e-25
Family Zf-UBP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0262190   Gene: FBgn0234659   Transcript: FBtr0263698
Sequence length 1136
Comment type=protein; loc=X:join(9427905..9427907,9428959..9429264,9429334..9429464,9429525..9429708,9430284..9430555,9430609..9432016,9432069..9432701,9432846..9432933,9433758..9434143); ID=FBpp0262190; name=Dyak\GE17180-PA; parent=FBgn0234659,FBtr0263698; dbxref=FlyBase:FBpp0262190,FlyBase_Annotation_IDs:GE17180-PA,GB_protein:EDX01762,REFSEQ:XP_002100654,FlyMine:FBpp0262190; MD5=f6217221725cf25a8292169578e16e61; length=1136; release=r1.3; species=Dyak;
Sequence
MSPPIVTRRSAQQAKIQTRAMASKSKTGTAGAAATAAGVISGGSASGGGGSSGSISSGFN
AADPRKTNKPNAALLEAKRRARNNMLKNQGSGAQECVTDIFQNAVNCKGLVRKPTALIYD
ESMSQHCCLWDKEHYECPERFTRVLERCRELNLAERCLELPSRSATKDEILRLHTEEHFE
RLKATAGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLIAGKAHNGMAII
RPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRV
VYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPV
ALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDS
LAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCADL
QDRDKEQELHKVLRHWIGGPPPVDRYPTRDTAIPLPPEKLASNAARLQVLRTETKLSVPS
VRVCYAYDAQMLLHCNLNDTGHPEQPSRIEHIHKMHGEYALLPRMKLLSARAATTDEVCL
AHTRAHVNTVRRLLGREPEDLYGAAAIYNSVYLHPRTFDCATLAAGSVLQAVDSVLRGES
RSGICNVRPPGHHAEQDQPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHI
FESNPKVLYISLHRYEHGAFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAF
QQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALASGRIIVCLE
GGYNVNSISYAMTMCTKTLLGDPVPTPQLGAAALQKPPTVAYQSCVESLQQCLQVQRNHW
RSLEFVGRRLPSDPVVGENNNEDFLTASLRHLNISNDDASGAAGGPAGDQPDCGDERPSG
SKPKVKVKTLTDYLAENKEALEQNEMFAVYPLKTCPHLRLLRPEEAPQSLDSGAACSVCG
STGENWVCLSCRLVACGRYMNAHMEQHAVESQHPLAMSTADLSVWCYACSAYVDHPRLYA
YLNPLHVDKFQEPMAWTHGCARREDGCYALGPDGRDEDSEDGVAGSSYCLRLERNN
Download sequence
Identical sequences FBpp0262190 7245.FBpp0262190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]