SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0262345 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0262345
Domain Number 1 Region: 4-32,86-157
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-25
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 171-275
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000994
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0262345   Gene: FBgn0234806   Transcript: FBtr0263853
Sequence length 1007
Comment type=protein; loc=X:join(11341655..11341796,11345105..11345403,11345473..11345724,11345792..11345895,11346013..11346160,11347073..11349151); ID=FBpp0262345; name=Dyak\GE17335-PA; parent=FBgn0234806,FBtr0263853; dbxref=FlyBase:FBpp0262345,FlyBase_Annotation_IDs:GE17335-PA,GB_protein:EDX02045,REFSEQ:XP_002100937,FlyMine:FBpp0262345; MD5=6429f8ec0910d3f74812613bf55a5ee3; length=1007; release=r1.3; species=Dyak;
Sequence
MSPNRWILLLIFYISYLMFGAAIYYHIEHGEEKITRGEQRKAQIAINEYLLEELGDKNTT
TQDEILERISAYCDKPVTLPPTYDDTPFTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRM
IMIAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIA
LIPGIALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGSNQPKEFGGWFV
VYQIFVIVWFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVG
YLRRMLNELYILKVKPVYTDVDIAYTLPRSNSCPDLSMYRVEPAPIPSRKRAFSVCADMV
AAQKEAGMVHANSDTELSKLDREKTFETAEAYRQTTDLLAKVVSALATVKPPPAEQEDAA
LYGGYHGFSDSQILASEWSFSTVNEFTSPRRPRARACSDFNLEAPRWQSERPLRSSHNEW
TWSGDNQQIQEAFNQRYKGQQRANGAANSTMVHLEPDALEEQLKKQSPGAGRVKKFSMPD
GLRRLFPFQKKRPSQDLERKLSVVSVPEGVISQQARSPLDYYSNTVTAASSQFYLRNGRG
PPPPFESNGSLASGGGGLTNMGFQMEDGATPPSALPGGGAYQRKAAAGKRRRESIYTQNQ
APSARRGSMYPPTAHALAQMQMRRGSLATSGSGSAAMAAVAARRGSLFPATASASSLASA
PRRSSIFSVTSEKDMNVLEQTTIADLIRALEVVHTHAVLDEQQQAAAAGGAAVGGGASKG
SRKQRKMGNAGLEPPQLPPILSLFAGDQTRTLQAAAANRLYARRSTIVGISPTGGAATGP
AARSLLEPPPSYTERAANQSQIAAGNTVSGSTNAPAVQSKFRRRFSVRPTALQIPPGQAP
PPGASLMEQSSQSALQRRLSLRPSPLARELSPTSPPGGSGSALPAGAIEESGGTSAQRLL
PLPAGTRPSTSSTHSPLSRIVQISQAQRKSSMPSAAATGSSGAPGEK
Download sequence
Identical sequences B4PYW7
XP_002100937.1.41174 XP_015046093.1.41174 XP_015046094.1.41174 FBpp0262345 7245.FBpp0262345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]