SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0264241 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0264241
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1086-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-21
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family SPRY domain 0.061
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4207-4269
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2251-2349
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000589
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0264241
Domain Number - Region: 452-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1532-1657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0261
Family SPRY domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0264241   Gene: FBgn0236585   Transcript: FBtr0265749
Sequence length 5127
Comment type=protein; loc=2L:join(17409116..17409169,17411938..17412141,17413076..17413153,17413217..17413605,17413669..17414193,17414249..17414373,17414432..17415854,17415911..17416514,17416650..17416749,17418202..17418406,17418481..17419237,17419297..17420456,17420670..17420864,17420938..17421053,17421742..17424014,17424184..17424663,17425228..17425365,17425525..17425811,17425875..17427972,17428327..17428439,17429061..17429406,17429629..17429929,17430207..17430317,17430377..17430796,17430857..17431058,17431122..17433801); ID=FBpp0264241; name=Dyak\GE19231-PA; parent=FBgn0236585,FBtr0265749; dbxref=FlyBase:FBpp0264241,FlyBase_Annotation_IDs:GE19231-PA,GB_protein:EDW89402,REFSEQ:XP_002089690,FlyMine:FBpp0264241; MD5=f4c20d51a3128a5c459d0db99632124f; length=5127; release=r1.3; species=Dyak;
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAYLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLAVPIITFTFNGVKVRGSFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLSKN
VLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFRT
YRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSEFIGEQEKARRWD
EIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHLM
RGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFS
KKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQGP
KQLSASNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHS
REFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGC
FVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAA
VLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLA
LHIPEEDRCIDILELIEMEKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSEEEMQHSLRSL
VTESVRPQLRMTEITPPVIATSSMPSVSSEPIPDIDQLYSPKFPLEVVRQFVMEALKDAV
EINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREG
KDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYI
EIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEADDQDNCTCGLELRGRLGDFHDS
LMQKVSLNALQEPDGVEGTAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEV
FRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRAREDVA
EMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMN
TLGRRAQAQSDAPTQPEGAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFD
FLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSE
LVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEG
EGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAILNFY
CTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKP
KSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDM
ALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDF
LVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGA
SSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYG
RQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDN
DRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVPLNHRGSTRRQSKP
QINDFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVI
HPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFS
YSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRN
YFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGID
ARTLTKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVV
LPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHR
PALGSCLGAYSSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETIL
AEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNP
LLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLH
KEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEA
EELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVGGKV
KKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYD
VIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQE
TVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACN
IFARSYYEQWLQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGA
MTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLL
FHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKK
DVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQL
TCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKAN
FFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQV
DLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLAD
LIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVE
HFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRI
ERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASG
LMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQ
IGVMQTKSIPELIVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEPVVE
EETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGESSPEDGA
APSGELVEGEPHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSSAPQ
ETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAE
EELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACL
HSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAK
SFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYIMNIDWRY
QVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGK
QLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGG
IGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMES
NCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQ
RSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences B4P3C9
7245.FBpp0264241 XP_002089690.1.41174 FBpp0264241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]