SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0265927 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0265927
Domain Number 1 Region: 57-130,161-240,286-346,400-447
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.64e-23
Family Ankyrin repeat 0.007
Further Details:      
 
Domain Number 2 Region: 622-669
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000101
Family SOCS box-like 0.0082
Further Details:      
 
Weak hits

Sequence:  FBpp0265927
Domain Number - Region: 412-535
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0373
Family Ankyrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0265927   Gene: FBgn0238205   Transcript: FBtr0267435
Sequence length 671
Comment type=protein; loc=3L:complement(1725045..1725812,1725867..1725970,1726021..1726353,1726437..1727247); ID=FBpp0265927; name=Dyak\GE20917-PA; parent=FBgn0238205,FBtr0267435; dbxref=FlyBase:FBpp0265927,FlyBase_Annotation_IDs:GE20917-PA,GB_protein:EDW92902,REFSEQ:XP_002093190,FlyMine:FBpp0265927; MD5=04b94388c25c59d2152ee8d2d7e1c8c3; length=671; release=r1.3; species=Dyak;
Sequence
MGGSVSQVFRSGSALLSHRDGKLSKATEETIQTLFDILRANPKVSLQTLESLLIQIPKNE
NILAMHDDYGYNILQRSVGLNHIDLTKWLLHRHRPDVNRSPCSLPLHIATLRGYEECVEL
LLRHGARIDVDTRMCFPGAHTRNCEESGKWHNNVDDVSERLNTKLQNALFYAIDGDQYNV
LSLLTQKMEEPWIPFRVKKPLLHLACERGAWNCVQQLVVTRSEEINLIMDEYYPIHHAVL
HDGRFLELLIHQGAITTVRTCTQQMTLLHVVIFAARKSAEDTLATLRILLERGCKELINA
PDSLGNTPLHALIVRYALEEARYGYDKWSKWDVLHLVRFLLQNGAKQSINQAGNSAMACV
FRHLRDWEVCYELLSMLIKENGDPNIVGRDGSVPIMVLLVPLINKDHLHHFTHSMKVCYL
NCIRMLLQHGANPNCSYRANLKPLHVLVFTVSENFTLNCDAQKRTNFDFIKNILLMLLQH
GLDCNKTYQHILQAVMDMVHNVRTCHDMECVYELTLTLIQYGADPNIVLSGKTTPGTAIF
SNELATFRSSFRTNSCYLLFYYIILITKKEFILNDPHATYTRVIHLFYLTMHHEPLFNCL
KSLHNFYVAQVPSKKTEQLIALISSLYRRPRSLKQLSRWAIYEAMNRKLAQNINCLNLPG
PLKDYVLQFER
Download sequence
Identical sequences B4PDT7
7245.FBpp0265927 FBpp0265927 XP_002093190.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]