SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0270574 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0270574
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.58e-65
Family BAR domain 0.000000814
Further Details:      
 
Domain Number 2 Region: 286-362
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-23
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0270574   Gene: FBgn0242628   Transcript: FBtr0272082
Sequence length 369
Comment type=protein; loc=3R:3403060..3404169; ID=FBpp0270574; name=Dyak\GE25564-PA; parent=FBgn0242628,FBtr0272082; dbxref=FlyBase:FBpp0270574,FlyBase_Annotation_IDs:GE25564-PA,GB_protein:EDW95961,REFSEQ:XP_002096249; MD5=1e3737cac61b5f6715c5ff6b65f0baa2; length=369; release=r1.3; species=Dyak;
Sequence
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQP
NPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGE
ALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDD
EIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQ
EKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAV
TPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQ
VQVPLPNGN
Download sequence
Identical sequences B4I239 B4PM29 B4QTX8 B5RIU6 Q8I1I3 Q8T390
FBpp0083112 FBpp0083113 FBpp0217657 FBpp0270574 FBpp0083112 FBpp0083113 FBpp0141628 FBpp0083112 NP_001262717.1.81976 NP_620122.2.81976 NP_732383.1.81976 XP_001979591.1.56816 XP_002038178.1.34323 XP_002096249.1.41174 XP_016034101.1.80810 FBpp0199372 7227.FBpp0083113 7245.FBpp0270574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]