SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0270618 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0270618
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.51e-62
Family Calponin-homology domain, CH-domain 0.0000403
Further Details:      
 
Domain Number 2 Region: 385-524
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000317
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 310-416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000806
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 4 Region: 1245-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000142
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 5 Region: 1140-1240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 6 Region: 1388-1483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000432
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0270618
Domain Number - Region: 491-617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 2244-2325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000475
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 1009-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00118
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 1454-1583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0482
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0270618   Gene: FBgn0242670   Transcript: FBtr0272126
Sequence length 2354
Comment type=protein; loc=3R:join(4022191..4022212,4038566..4038720,4038925..4042389,4042459..4042773,4042839..4043144,4043724..4044226,4044513..4044600,4045928..4046977,4047069..4047301,4047707..4047868,4047930..4048089,4050142..4050237,4050303..4050435,4056032..4056195,4056286..4056391,4057352..4057458); ID=FBpp0270618; name=Dyak\GE25608-PA; parent=FBgn0242670,FBtr0272126; dbxref=FlyBase:FBpp0270618,FlyBase_Annotation_IDs:GE25608-PA,GB_protein:EDW96035,REFSEQ:XP_002096323,FlyMine:FBpp0270618; MD5=a2cb6aee53ee6b29a3a8724f49c0dfac; length=2354; release=r1.3; species=Dyak;
Sequence
MEPGILIDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTHTSLK
PEKGRMRVHHINNLNKVITVIQQHGVKLVNISSDDIVGGHPKLTLGLIWLIALEFNGQHL
VKSHSSNGVEKSLLAWARQYTEAHGLQLNDFSSSWSDGRAFLMILDAHVEELNLQAALQQ
HALKRLHLAFDLAYSHFKIEKLLDAEDVHTHKPDNKSIQMYVMCLYHAMESMRTRQQEQE
QDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLFTSDSGGSMEQRSSAELKTHSMRPLS
TATNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDPQDFQTAKMQFHENESFMLKLTEH
QEYVGEALEEGSNLINESQKAGAGLSHEDQNEVRQQMVLLNERWETLRLRALDVQAKILM
RLAEFQKQKLEQLRQFLTSVEDRISHMSDLGPTLEEAERQLLEAQKLKADLSEQQELVDS
LSSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWSDLRSEKLQQYKCISRWLDAREQDL
KLMESRDVTDVGGITQRINELNYCAKDLLELQRYLIDLRQMVAATLQDGDDKGERVLIQL
ESYEDRLDALKQIVEVQTVRIETKGFNFGRDRASYDDSRVVRPEGWVDYQMIIRFGEEDC
QEEDEKHNLASKKRKLRNADNFNALENRIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE
LQAENSRRNGTLPELKKLYEVCELEDPSRNLLLEETHIKQLEQRYATLSKKLSSQQSESN
TLLAKEKYYNSLTGFKLVLADSRDWYKQHAGSASGNELEQRLSHMESLASEISEAKTATE
ELDDKLIEWKQDFGLFYDSWHDMKQALQALIQQRGGESLSRQLKQIQDFVTKVSNQKVRV
SNLEVMQKQQHVLNQLVDELESFRLTYDSIPKHLVGEELQATWNRLPEQLNERVIKQTTA
IENLNHFAAEYNAIIAVLRTAADFKLNGSDGGSNQDLRKLEIDVISARNFSEILIKEAEP
AQKESLQSQIRALNTLYDQVEQVHREKKQQQTVLQSQIDLIQLRLKKTDQWLTDLESNTP
KSGISDIGNSNELFQSKSRFQTLKETCEKETTQFRDLNERGGELLLQMDELQDQDRESRY
GSLAKQFTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTP
ENAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSMRRDIDDTVQRWT
QLQQQAKKRAELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLENDVTIEDLPEDFQR
LAREFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNLMEVRFKYCQAKLSKCTAPQP
AYESRLNRSYANLRNVERSTLVLDVASAGPNTVQAQYQKCLQIYRTLSEIKAEIESTIKT
GRRVCEDRYTKSPKQLSQRIDALKHLYNALGDNVTQSKAFLESLLTLARQLEECFDSADT
LIRRFESPQEVHDRNSILLEFEDVLRRCEDHYNEYRKSCDQSCMAETRQRIDGLKATYHK
LTSADIIKRLTEMKATLQNLDNISLETLKAMEHDLKEINVPSNPEIEKLQQQVIAIVVDV
LKTRFNEATTLAARNTSSPENDDTEIVVVSDTVRQRRARTPQSGESPSSAPTSSSESPTK
GVENSTVAVGDLPGGVLPDLLPPQTFRLAESSTLFSQISLNPEKVSKTPPPKPAKTKRKA
PSSPAQVVEIRVKNIQNDKMSVQNIDLEPQQGEIVDTVNILESVEPFVPEYVETVQIVDL
SEDSDSSVRVDSQGKEVRRSRSKHSLNDAPLPKVSDNDEDSAEQEEDLIRPSAGNTSTPF
LRVEKHRISFDEKRKRVANERDILRDFEEEEPKTPDTPRSAQVSKPKRWRQLQPEIDALE
PESPGRDSFYSPDKESGFDAEPLVFSDDEDIPRFSLEMTPTIDSDSDTSRIETPSTKKPN
PFLSKVLESMPSPVDDSNVTLKSPLSEQLPQNLDDRVREFDKQAKQMIYKLKLTKAKIEQ
CHESEAEDLRLLIAPDAATLISQGDSLVLETHGRQGSISRLVMRTQIILREQFREVQQAT
SNTSGSGTPAPPLDSVNIEELVTKGLRRINVLIEKTVDLKSSSDLEKRMEDINERHDDLQ
VIVSAIGKNAQMPKVTPLMMNEIEKTKNNLIAHADSIELSLTELRNGPRISNGKERPDAS
SAATMSCRSEYNNEPSGTGALAGSFDKSVLQISDWLTWEQNMIKIQSVLVDDGDAVRLAI
EKQEKVLRELKMKKPQLNELVHTAEVLKGDVKRQQLQEKATELRAHAFGERSFERKLSVS
FTLLLFVAFFSAEF
Download sequence
Identical sequences 7245.FBpp0270618 FBpp0270618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]