SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0192230 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0192230
Domain Number 1 Region: 153-321
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.34e-43
Family Pentapeptide repeats 0.00067
Further Details:      
 
Domain Number 2 Region: 34-134
Classification Level Classification E-value
Superfamily POZ domain 1.73e-27
Family Tetramerization domain of potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0192230   Gene: FBgn0165699   Transcript: FBtr0193738
Sequence length 335
Comment type=protein; loc=scaffold_6:join(334631..335191,335433..335564,335660..335974); ID=FBpp0192230; name=Dsec\GM10753-PA; parent=FBgn0165699,FBtr0193738; dbxref=FlyBase:FBpp0192230,FlyBase_Annotation_IDs:GM10753-PA,GB_protein:EDW54829,REFSEQ:XP_002038292,FlyMine:FBpp0192230; MD5=bd29e9f999be8a0711b86b9e01ab5f62; length=335; release=r1.3; species=Dsec;
Sequence
MNSDLKESGSGARKDVAAPAAGNFVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSM
LARMFLQDGSMMPSERDEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVMGVLEEARF
FGIFSLVTHLEERLGQQETPLGDRPLTRNDVIKAIIQTSVITELRFQGVNLSGADLRKLD
FRNINFKYANMSHCNLSHTNLNYCCLERADLQYANLECAQLVSVRGLCANMEGANLRGCN
FEDPTGVRTNLEGVNLKGACLESSNMAGVNLRVANLKNANMKNCNLRAAVLAGADLEKCN
LSGSDLQEANLRGANLKDAELTLMVTPLHMSQAIR
Download sequence
Identical sequences B4I3N6
FBpp0192230 XP_002038292.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]