SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0203015 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0203015
Domain Number - Region: 29-112
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000216
Family Insect pheromone/odorant-binding proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0203015   Gene: FBgn0176418   Transcript: FBtr0204523
Sequence length 173
Comment type=protein; loc=scaffold_1:join(7768348..7768434,7768490..7768585,7768643..7768981); ID=FBpp0203015; name=Dsec\GM21538-PA; parent=FBgn0176418,FBtr0204523; dbxref=FlyBase:FBpp0203015,FlyBase_Annotation_IDs:GM21538-PA,GB_protein:EDW47850,REFSEQ:XP_002033837,FlyMine:FBpp0203015; MD5=c8ed804267b2c4231ab52b551651ca06; length=173; release=r1.3; species=Dsec;
Sequence
MLHLLTWVLIFIPAFRAADPICSQRPDVTALKNCCKLLNLNFSSFNSKCSQYLVNGAHIS
PCSFECIFQAANALNGTHLVMENIEKMMKTILDSDEFVQVYVDGFRSCGNQENVLIKTLK
RRRVPITGKCGSMAIMYGLCAHRYVYRNCPDSVWSKSPNCNEAREYNTRCDDL
Download sequence
Identical sequences B4HRC1
FBpp0203015 XP_002033837.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]