SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0192366 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0192366
Domain Number 1 Region: 4-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.00024
Further Details:      
 
Domain Number 2 Region: 77-256
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000337
Family Nuclear receptor ligand-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0192366   Gene: FBgn0165835   Transcript: FBtr0193874
Sequence length 278
Comment type=protein; loc=scaffold_6:join(2260307..2260931,2261380..2261591); ID=FBpp0192366; name=Dsec\GM10889-PA; parent=FBgn0165835,FBtr0193874; dbxref=FlyBase:FBpp0192366,FlyBase_Annotation_IDs:GM10889-PA,GB_protein:EDW55093,REFSEQ:XP_002038556,FlyMine:FBpp0192366; MD5=f6fc459bf61410df8d994a6918f285e2; length=278; release=r1.3; species=Dsec;
Sequence
MSNFSACAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALAGNCVVDKARRNWC
PSCRFQRCLAVGMNAAAVQEERGPRNQQVVLYRSGRRHAPPSQAAPSPTPHSQALHFQIL
AQILVTCLRQAKANEQFALLDRCQQDAILQVVWSEIFVLRASHWSLDISAMIDGCGDEQL
KRLICEAHQLRADVLELNFLESLILCRKELAISAEYAVILGSHSNAALISLARYTLQQSN
YLRFGQLLLGLRQLCLRRFDCALSCMFRSVVRDILKTL
Download sequence
Identical sequences B4I4F0
FBpp0192366 XP_002038556.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]